KEGG   Mycobacterium rhodesiae: MycrhN_0592Help
Entry
MycrhN_0592       CDS       T01685                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00250  Alanine, aspartate and glutamate metabolism
mrh00410  beta-Alanine metabolism
mrh00430  Taurine and hypotaurine metabolism
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh02024  Quorum sensing
Module
mrh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_0592
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MycrhN_0592
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MycrhN_0592
   00430 Taurine and hypotaurine metabolism
    MycrhN_0592
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MycrhN_0592
Enzymes [BR:mrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MycrhN_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEV71230
UniProt: G8RN98
LinkDB All DBs
Position
complement(612232..613620)
Genome map
AA seq 462 aa AA seqDB search
MTRKHSHSRGQHITPAYTCRMEMSPVPSLRLPDEPMDPDAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPQAERLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEDLRDDDPNSA
VGVSTIGSSEAVMLAGLAMKWRWREKVGKDWKGRTPNLVMGANVQVVWEKFCRYFDVEPR
YLPMAEDRYVITAEQVLEHIDEDTIGVVAILGTTYTGELEPIGEICAALDKLALDGGVDI
PVHVDAASGGFVVPFLHPHLEWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRSAEYLPED
LVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRGGYAKVMQCLSSTARWLGDQLG
ESEHFEVVADGSAIPVVSFRLKGDFGYTEFDVSHALRSYGWQVPAYTMPDGAEDVTMLRI
VVREGFSADLARALYDDVKTALSHLDALKPQGHFDQLEPFAH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaagcacagccacagccgcggacaacacatcaccccggcgtacacgtgccgg
atggagatgtcgcccgttccttcgctgcggctgcccgacgagccgatggatcccgatgcc
gcctataggttcatccacgacgagctcatgctcgacggcagttcgcggctgaacctcgcc
acgttcgtcaccacgtggatggatccccaggccgaacgcctgatggccgagacgttcgac
aagaacatgatcgacaaggacgagtaccccgcgaccgccgcgatcgagcagcggtgtgtg
tgcatggtggccgacctgttccacgccgaggatttgcgcgacgacgacccgaacagtgcc
gtcggggtatccaccatcgggtcgagcgaggccgtgatgctcgccggccttgcgatgaag
tggcggtggcgcgagaaggtgggtaaggactggaagggccggaccccgaacctggtgatg
ggggccaacgtccaggtcgtgtgggagaaattctgccgctacttcgacgtcgaaccgcgg
tatctcccgatggccgaggaccgctatgtcatcaccgccgagcaggtcctggagcacatc
gacgaggacaccatcggcgtggtcgccattctgggcacgacgtatacgggcgagctcgag
ccgatcggcgagatctgcgcggcgctggacaagttggccctcgacggcggtgtggacatt
ccggtgcacgtcgacgcggccagcggcggcttcgtcgtgccgttcctgcatccccatctg
gagtgggacttccggctgccccgcgtcgtctcgatcaacgtgagcggccacaaatatggg
ctgacctaccccggcatcggattcgtggtctggcgcagtgcggaatacctgcccgaggat
ctcgtcttccgggtcaactatctcggcggtgacatgccgacgttcacgctgaacttctcg
cggccgggcaaccaggtcgtcggccagtactacaacttcctgcggctgggccgtggggga
tacgccaaggtgatgcagtgtctgtcatcgaccgcgcgctggctcggagatcagctcgga
gaaagtgagcatttcgaggtcgtcgcggacggttcggcgatcccggtggtcagcttccgg
ctcaagggtgatttcggctacacggagttcgacgtgtcgcatgccttacgttcttacggc
tggcaggtgcccgcctacaccatgccggatggagctgaggacgtcacgatgctgcgtatc
gtggtccgcgaggggttctctgcggacctggccagggcgttgtatgacgacgtcaagacc
gcgttgtcccacctcgatgcgttgaagccgcagggccacttcgaccagctggagccgttc
gcgcactga

DBGET integrated database retrieval system