KEGG   Mycobacterium rhodesiae: MycrhN_2050Help
Entry
MycrhN_2050       CDS       T01685                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
mrh  Mycobacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2082380..2083426
Genome map
AA seq 348 aa AA seqDB search
MASKAEEIDVDGIAVRLTNRDKPYFPKLGSAGTKGALFDYYLAVADRMVALLRDRPVHLQ
RFPDGIDGEEIYQKRVPQKHPDYLETCTVTFPSGRTADALKITHPSAIAWAAQMGTITLH
PWQVRCPDTEHPDELRIDLDPQPGTAFDEARQVALDVLKPVLDELGIVGYPKTSGGRGIH
VFVRIKTDWDFIEVRRAGIALAREVERRAPDAVTTSWWKEERGKRIFIDYNQNARDRTFA
SAYSARKTAIATVSTPLSWEELRDAEPDDYTIATVPDLVASRQDPWADIDSVAQSLEPLL
EMVHTDESERGLGDLPYPPSYPKMPGEPPRVQPSKKVAANWDDDGNPV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaaggccgaggaaatcgacgtcgacggcattgccgtccggctgaccaaccgt
gacaagccgtacttcccgaagctgggttcggcgggtaccaagggcgcgctgttcgactac
tacctcgcggtcgccgatcgcatggtcgcactgttgcgcgacaggccggttcatctgcag
cgcttccccgatggcatcgatggcgaggagatctaccagaaacgggtgccccagaagcat
cccgactacctggagacctgcacggtgaccttcccgtcgggtcgaactgcggacgcgctc
aagatcactcacccgtccgcgatcgcatgggccgcgcagatgggcaccatcacgctgcat
ccgtggcaagtacgctgccctgacaccgaacaccccgacgagctgaggatcgatctcgat
ccgcagcccggcacggcgtttgacgaggcccgccaggtcgcgctcgacgtgctcaagccg
gtgctcgacgaactcggaattgtcggctacccgaagacttccggcgggcgcggcattcac
gttttcgtgaggatcaaaaccgactgggatttcatcgaagtgcgccgcgccggaatcgca
ttggcgcgtgaggtcgagcggcgggcgccggatgcggtgaccacctcctggtggaaggag
gagcgcggaaagcggatcttcatcgactacaaccagaacgctcgcgaccgcaccttcgcg
tcggcgtattcggctcgtaagaccgcgatcgcgacggtgtcgaccccgctgagctgggaa
gaactgcgcgatgccgaacccgacgactacaccatcgcaacggtgcctgatcttgttgcg
tcccggcaggatccgtgggccgacattgattcggtggcgcagtcgctcgagccgctgttg
gagatggttcataccgacgaatccgagcgtgggctcggcgacctgccgtatccgccgagc
tatccgaagatgccgggggagccgccccgcgttcagccgagcaagaaggtggcggcgaac
tgggatgacgatggaaatccggtctaa

DBGET integrated database retrieval system