KEGG   Minicystis rosea: A7982_01901Help
Entry
A7982_01901       CDS       T04613                                 

Definition
(GenBank) Non-ribosomal peptide synthase
Organism
mrm  Minicystis rosea
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2171418..2173181)
Genome map
AA seq 587 aa AA seqDB search
MVCDGACRLSILESDARTWVDVVRGHAERTPAAIAFTFLVDGEEDEEHLTFGELDRRARS
VAVALRDAGYTGRRVLLLYPPGLDFIVAFVGCLYARVVAVPVYPPDPFRLERTVPRLSAI
SESAGALAILTTRAMVALAPVMLTHAPELAALPLLATDAFDDAPERWNGSDATCHDVAFL
QYTSGSTASPKGVVITHRNATANVRMMAEVGGHDRDTVIVSWLPAYHDLGLIGAILHPLH
LGARSVLFSPIAFIERPMRWPRALARHRATVTAAPNFAFDLCVRKSTPAERAKLDLSALR
MLMAGAEPINPTTLRRFAEAFGSSGLDTGAFFIGYGLAEATLSVSAGWPGSGLIRSFSSA
ALSEGRLEAIDENAGGAREVVSCGWPLPHQRVLVVDPESHVPCEPGRVGEVWVSGPNVAS
GYWNRPEETDATFAARLATGEGPFLRTGDLGAFHASELLVVGRRKDLIIVNGRNHAPQDI
EWTVQRAHPKLSTSSAAAFAVARDGAEELVVVAELPSSVDAREAEEVERAARRAVAREHD
LRLARVVFVAAKSLPKTSSGKLKRSAARDAYMNGSLDVSATAKEGTG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtgcgatggagcgtgccgcttgagcattctggagagtgacgctcggacgtgggtc
gacgtggttcgtggtcacgccgagcggacgccggctgcgatcgcgttcacgttcctcgtg
gacggtgaggaggacgaggagcacctgacgttcggcgagctcgatcggcgcgcgcgctcg
gttgcggtcgccctccgcgacgctggttacaccggccgacgcgttctcttgctgtacccg
cccggcctcgacttcatcgtcgcgttcgtcggctgtctttacgcacgcgtcgtggcggtg
ccggtctatccgcccgacccgtttcgcttggagcgcacggtgccgcgactctcggcgatc
agcgaaagcgccggcgcgctggcgatcctcacgacgcgagcgatggtcgctctcgcgccg
gtgatgctgacccacgcgcccgagctcgccgcgttgccgctgctcgccacggacgccttc
gacgacgcgcccgagcgctggaacggaagcgacgcgacgtgccacgacgtcgccttcctc
cagtacacgtcgggctcgacggcgagcccgaagggcgtcgtcatcacgcaccggaacgcg
accgccaacgttcggatgatggccgaggtcggagggcacgaccgcgacaccgtcatcgtg
tcgtggctcccggcgtaccacgacctcgggctcatcggcgcgatcctccaccctctgcac
ctcggcgcgcggagcgttctcttctctcccatcgcgttcatcgagcgccccatgcgctgg
ccgcgagcgctcgcgcgacatcgtgcgaccgtgaccgcagcgcccaatttcgcgttcgat
ctgtgcgtgaggaagtcgacgcccgcagagcgcgccaagctcgatctgagcgctctccgc
atgctcatggccggagcggagcccatcaatccaacgacactgcgccgcttcgccgaggct
ttcgggtcgagcggcctcgacaccggcgcgttcttcatcgggtacggcctcgccgaggcg
acgttgtccgtctccgcaggttggccgggcagcggtctgatccgatcgttctcttccgcc
gcgctctcggaaggccgcctcgaggccatcgatgaaaacgcgggcggagcacgggaggtg
gtgagctgcggctggcctctgccgcatcaacgcgtcctcgtcgtcgatcccgagagccac
gtgccctgcgagccggggcgcgtcggggaggtctgggtctccggacccaacgtcgcgtcg
ggctactggaaccggcccgaagagaccgacgccaccttcgccgcgcgcctcgcgacgggc
gagggtccgttcctccgcaccggcgatctcggagcgttccacgcgtcggagctcctcgtc
gtcgggcggcgcaaggacctgatcatcgtgaacggacgcaatcacgcgccccaagacatc
gaatggacggtccagcgagcgcatccgaagctttcgacgagcagcgcagcggcgtttgcc
gtcgcgagggacggagcggaagagctcgtcgtcgtcgcggagctgccgtcgagcgtcgat
gcgcgggaagcagaggaggtcgaacgcgcggcgcggagggcggtcgcgcgggagcacgat
ctacggctcgcgcgggtcgtgttcgtggcggcgaagagcctgcccaagacctccagcggg
aagctgaagcgcagcgctgcgcgagatgcgtacatgaacggctcgctcgacgtgagcgcg
acggcgaaagaaggaacgggctga

DBGET integrated database retrieval system