KEGG   Minicystis rosea: A7982_07530Help
Entry
A7982_07530       CDS       T04613                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
mrm  Minicystis rosea
Brite
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     A7982_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8679334..8679945
Genome map
AA seq 203 aa AA seqDB search
MIDLYTFGTPNGKKASVMLEEVGLPYELHVIDIRNGDQHKPEFRAINPNGRIPAIVDRDA
ENGPLAVFESGAILIYLAEKTGKLLAPRGPARYEALEWVMFQMGGVGPMFGQFGHFNTFA
PEKIPYAIDRYQKESNRLLGVLDGRLAEKEYLAGEYSIADVCTYPWVAGMQGRLPGAGDF
PHVNAWLERVGARPAVKKGMNVP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctctacaccttcggtacccccaacggcaaaaaggcctccgtcatgctggag
gaggtcggcctgccgtacgagctgcacgtcatcgacatccgcaacggcgaccagcacaag
cccgagttccgcgccatcaaccccaacgggcgcatccccgccatcgtcgatcgcgacgcg
gagaatggccctctcgccgtcttcgagtccggcgccattctgatctacctcgccgagaag
acgggcaagctcctcgcgccgcgcggcccggcccgctacgaagccctcgagtgggtcatg
ttccagatgggcggcgtcggccccatgttcggtcaattcgggcacttcaacaccttcgcg
cccgagaagatcccgtatgccatcgatcgctatcaaaaggagtcgaaccgcctcctcggc
gtcctcgacggccgcctcgccgagaaagagtatctcgccggcgagtattccatcgcagac
gtgtgcacctatccgtgggtcgcaggcatgcagggccgtttgcccggcgccggcgacttc
ccccatgtgaacgcctggctcgagcgcgtcggcgcgcgccccgccgtgaaaaagggcatg
aacgtgccctag

DBGET integrated database retrieval system