KEGG   Minicystis rosea: A7982_10331Help
Entry
A7982_10331       CDS       T04613                                 

Definition
(GenBank) Non-ribosomal peptide synthetase
Organism
mrm  Minicystis rosea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding TraD AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: APR84982
UniProt: A0A1L6LTH2
LinkDB All DBs
Position
complement(11780830..11782641)
Genome map
AA seq 603 aa AA seqDB search
MSGYVARTVVQAIEDAAVSTQTGYRFIDENSDAEPFFTHAGIERASARYGGALQSMGLKK
GDRVALILPDNADFVFSFLGALRAGIIPVPIYPPTGLGKLAGYLDNTLHIVAKSGAKVLL
TSTDIKKMLGTIAAQAPELKQVVAVEGVRSMKEELKPVKVGLDDTCFFQFTSGSTSRPKG
VVLTHANMAANVRAIMQLGLGVRDSVDSGASWLPLYHDMGLIGFVIAPLYHVNTITFLPP
LLFLKRPARWLETMSRHRASISFGPNFAYALCVKRIKDSEIAGLDLSNWRVAGCGAEPIR
AENLKAFADRFSSIGFSDKAFVCCYGMAESTLAISFSNVGTGVKTDVVDGEALWSRGEAT
PIAADSEKAAPIVQCGGHFPEHDIQAFALDDENSERPLPERKVGELRLRGPSLMTGYFNE
PELTAKAFAGGWLKTGDLGYLADGKVHICGRSKEVIIVNGRNYYPQDLEWEASKVEGVRK
GNVIAFGTMKPHNDRERVIICFETAVSGDAQQTALKGEVRRVVQQALGLTVDDVVPLPVG
VLPKTSSGKLQRAKTRELYETGGLLDRTSAREVDKVEVVKELAKSQLGYFRHALFGKKDE
PKE
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatacgtcgcacgcacggtcgtccaggccatcgaggacgccgcggtcagcacc
caaacgggctaccgcttcatcgacgagaacagcgacgccgagcccttcttcacgcacgcg
gggatcgagcgggccagcgcgcgctacggcggtgcgctccagtcgatgggcctcaagaag
ggagatcgcgtcgcgctgatcctcccggacaacgccgacttcgtcttctccttcctgggc
gcgctccgcgccggcatcatcccggtgccgatctacccgcccacgggcctcggcaagctc
gccggctacctcgacaacacccttcacatcgtggccaagagcggggcgaaggtcctgctc
accagcaccgatatcaagaagatgctcggcaccatcgctgcgcaggcccccgagctcaag
caggtggtcgcggtcgaaggcgtgcggtcgatgaaggaggagctcaagcccgtgaaggtc
gggctcgacgacacctgcttcttccaattcaccagcggctcgacctcgcgccccaagggc
gtggtcctcacgcacgccaacatggccgccaacgtgcgcgccatcatgcagctcggcctg
ggcgtgcgcgactcggtggactccggtgcttcgtggctgccgctctatcacgacatgggc
ctcatcggcttcgtgatcgcgccgctctaccacgtgaacaccatcacgttcctgcccccg
ctcctcttcttgaagcgcccggcccgctggctcgagacgatgtcgcgccaccgcgcctcc
atctccttcgggccgaacttcgcttatgccctctgcgtcaaacgcatcaaggacagcgaa
atcgccggcctcgatctgtcgaattggcgcgtcgccggctgcggcgccgagcccatccgc
gccgagaacctcaaggccttcgccgatcgcttctcgtccatcggcttcagcgacaaggcc
ttcgtgtgctgttatggaatggccgagtccaccctcgccatctccttcagcaacgtgggc
acgggcgtgaagaccgacgtggtcgacggcgaggccctctggtcccgcggcgaggccacg
cccatcgcggcggacagcgagaaggccgcgcccatcgtgcaatgcggcggtcacttcccc
gagcacgacattcaggccttcgccctcgacgacgagaacagcgagcgtcccctccccgag
cgcaaggtcggtgagctccgcctccgcggccccagcctgatgacgggctatttcaacgag
cccgagctgaccgccaaagccttcgccggcggctggctcaagacgggcgacctcggctac
ctcgccgacggcaaagtccacatctgcggccgctccaaagaggtcatcatcgtcaacggc
cgcaactactaccctcaagatctggagtgggaagccagcaaggtcgaaggcgtccgcaaa
ggcaacgtcatcgccttcggcaccatgaagccccacaacgatcgcgagcgcgtcatcatc
tgcttcgagaccgcggtcagcggcgacgcccagcaaaccgccctcaaaggcgaggtccgc
cgcgtcgtgcaacaagccctcggcctcaccgtcgacgacgtggtccccctccccgtcggc
gtcctcccgaagacctcgagcggcaagctccaacgcgccaagacccgcgagctctacgaa
accggcggcctcctcgaccgcacctccgcccgcgaggtcgacaaggtcgaagtcgtcaag
gagctcgccaagagccagctcggctatttccgccacgcgctcttcgggaagaaggacgag
cccaaggagtaa

DBGET integrated database retrieval system