KEGG   Moniliophthora roreri: Moror_11412Help
Entry
Moror_11412       CDS       T03137                                 

Definition
(RefSeq) histone-lysine n-methyltransferase
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mrr  Moniliophthora roreri
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mrr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Moror_11412
Enzymes [BR:mrr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Moror_11412
Chromosome [BR:mrr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Moror_11412
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Moror_11412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 821 aa AA seqDB search
NDKCEIRVFDTESEREMDKAMTRMTMGTLKQKLFAAWSGFLSMSGFDTEAPVQMDEFKVA
FYGDQAKMREAKSEDDIREDPRKQVLAGQVEILRGRINSKFNHSLIPSINKGMSTYTIGQ
DEQLDEELEDPGLWEASSSEAEDWSGMDPDQEWPLHIAGEEVRDGKTRYEIVWETWSRKD
RTNSTWNEEGIEGDDVLKGWKKESDRRRKKLAEESSDINIWSDLDLLSTDTHFHAQAGQE
KLEASRKGRSHRPNLVERMRELEIKHGIQPQRQKEREEEEEVASSLRRRPSPGPSTRPAK
RRQTTDPRGVRSTSYEQLRFISPVSTGPPPSVASSSSASEQTRSSSTRSGSSTSYDQLRF
ISPISMGPPPSVAGSSSASGQTRSSSTLSSSAKSLRKLSETPVSSTSTPNLKRHSTDSDV
TMREASTSSSARKRGRPHKGTSIKTITSDSEDDDNHSMTLRETPARRERPATPSQVSVKG
KEKAVPQARIRRAPSEVYIRGPRSVQKGCSNDSEPLSRREILQREWNAAAKLVSAKGITI
VNDIDDEEIPVLDSDFEYLENDYVYDVDKEIPDPEGFFEFCTHRSCTKAKKCGCQQAHPV
LDSNNSPTFPYSADNEGYFIYYDEVDNDGPILVVECNQYCKCGPDCPNRVAQRPRDVPVE
IFKTEECGWGVRSPQDIEQGKVLGLYTGKIIYRHVAEKMRGAEKAYCFDLDGTEDGTEET
VDEDRSYTVDSRLCGNWTRFLNHSCSPNLKVYSAVWQTVPESNLPSLVFYAAKDIKAGTE
LTFDYDPGAARTWKANGKKGKVRGGSIVCHCGSEDCRGWVV
NT seq 2468 nt NT seq  +upstreamnt  +downstreamnt
tgaacgacaaatgcgaaattcgagtgtttgacaccgagtcggagagggagatggataaag
ctatgactcggatgacgatgggaactctcaagcagaagctctttgcagcatggtctggat
ttctaagtatgtctggttttgacacagaggcgccagtgcaaatggacgagttcaaagtgg
ccttttacggtgatcaagccaaaatgagagaagccaaatctgaagatgatattagggagg
atcccagaaagcaggtgcttgctgggcaggtggaaatcctgaggggtcgcatcaactcaa
agttcaaccattccctcattccctcaatcaacaaaggaatgtcaacctacacaatcggac
aagacgagcaacttgacgaggaacttgaagatcctgggctatgggaagcctcgagctcag
aggcggaggattggagcggtatggacccggatcaggaatggccattgcatattgcaggag
aagaggttcgagacggaaagacaagatatgagattgtttgggaaacctggtcacgcaagg
atagaacaaattctacctggaacgaggaaggtattgagggagatgatgtcttgaaagggt
ggaagaaagagtcagacagacgtcgaaagaagctcgcggaggagtcctcggatattaata
tctggtctgatttggatctcctgagtaccgacacccatttccatgctcaggcgggccaag
agaagttggaggcatcacgcaaaggacgttcacatcggccgaatctcgtagaacggatga
gggagttggaaatcaaacatggaatacaaccgcagcggcagaaggaacgggaggaggagg
aagaagtagcaagctctttgcgccgtcgccccagtcccggaccgtccaccagaccagcaa
aacgaagacagacgacagatcctcgcggtgtcagaagcacttcctatgaacagctcaggt
tcatatcacccgtcagtacgggaccacctccctcggttgctagttcgtcgtctgcctcgg
aacaaactcgaagttcatcgacccgttctggcagcagcacttcttacgaccaactcaggt
ttatatcaccgatcagtatgggaccccctccctcggttgctggctcgtcgtctgcttcag
gacaaactcgaagttcatcgaccctttcttcgagcgcgaagagcttgaggaagctttccg
aaaccccggtatcgtctacatctacacccaacttgaagagacactccacggatagcgacg
tgactatgagagaggctagcacctcctcttcagcgcgtaaacgtggtaggcctcacaagg
gaacgtctatcaaaactatcacttccgactcggaggacgacgacaaccactccatgactc
tcagagaaaccccggccagacgtgaaaggcctgcaactccatcacaggtttcagtaaaag
gaaaagagaaggccgtcccacaggcacgtatcagacgcgcgccgtccgaagtgtacatca
gagggcctcgttcagttcaaaaagggtgctcgaatgattctgaaccattgtcaagacgag
agatcttgcaaagagaatggaacgccgccgcaaaactcgtcagcgccaaaggaattacga
ttgtgaacgatatcgacgatgaagagatcccagttctcgattctgattttgaatatcttg
aaaacgattacgtctatgacgttgacaaagagattccagacccagaaggtttctttgaat
tttgtacgcaccggtcatgcaccaaagcaaagaaatgtggttgtcaacaagcgcaccctg
ttttggatagcaacaattcgccaacttttccgtactctgcagataacgaaggttacttta
tttattatgatgaagttgacaatgatggtcctatacttgtggtagaatgtaatcagtact
gcaaatgcggtccagactgtccgaatcgtgttgctcaacgacctcgagatgtacctgtag
agatattcaagacggaggaatgcggatggggagtacgatcaccgcaggatatagagcagg
gtaaagtgttggggttgtatactggcaaaatcatctatcgacacgttgcagagaaaatga
gaggtgccgaaaaggcctactgtttcgatttggatgggacagaggatgggacagaagaga
cggtggatgaagatagatcttatactgttgattctcggctttgtggaaactggactcgat
tcttaaatcattcttgttcacccaatctaaaagtctactctgctgtttggcagactgtac
cagagagcaacttgcccagtctggtcttttacgccgccaaggatataaaagccggaactg
agctcacgtttgactatgatccaggtgcagccagaacatggaaagcgaatggtaagaagg
gcaaggtacgaggtggctcgatagtatgtcattgtggctcagaggattgtcgcggttggg
tggtatga

DBGET integrated database retrieval system