KEGG   Moniliophthora roreri: Moror_12834Help
Entry
Moror_12834       CDS       T03137                                 

Definition
(RefSeq) glutathione transferase
Organism
mrr  Moniliophthora roreri
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 291 aa AA seqDB search
MPPTDSGKHYHKECTGIALQTVQAHSEPQDITLFGSCFCPFVQRVWVAFEFLQIPYKYYE
VDPYKKPQDLLEVSPKGLVPGLKLNTFNPPKALNESTVILEYLNDLAANSNGRTLLPPTT
NPYARALVRLQSDHISRSLVPSFYRYLQAQDTEAQIQGGKEFADAIQGLVSLFERTEKEV
LNVSTAGEGEKKALAIGLGLWVEGNKDIGLADAMAGPWLYRATNVLKHYRGFEMPRGQKF
SAWLERLFEHPAFKATCSTEELYLDSYERYAFNRPNTSQVANAINSGRSLP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaacagactctggcaaacattatcacaaagaatgcaccggtatcgctctgcag
actgtacaagcacattctgaaccgcaagatatcactcttttcggtagctgcttctgtcct
tttgttcaacgagtctgggttgcatttgagtttcttcagattccttacaaatattatgaa
gtggatccttacaaaaaacctcaggatctcctcgaagtttcgcccaaaggtcttgttcct
ggactcaagctgaacaccttcaacccaccgaaagctctcaacgaaagtaccgtcatattg
gagtatctgaacgacttggctgcaaactcgaatggacgaacacttctacctccaacgacc
aatccatatgcacgagctttggttcgtcttcaatcagaccatatcagtcgttctctcgtc
ccttcattctaccgataccttcaagcacaagacactgaagctcaaatccaaggaggaaaa
gaatttgctgacgccattcagggcctcgtatccctttttgagcggacggagaaagaagtt
ttgaatgtcagtacagcaggcgaaggtgagaagaaagcgttggcgataggactggggtta
tgggtcgaagggaataaagacattggattagcagatgctatggcagggccttggctgtac
cgcgcaaccaatgtcttgaagcattaccgaggcttcgaaatgccacgcggacaaaagttc
agcgcttggctcgaacgattatttgaacatcccgcattcaaggctacgtgctctacggaa
gagctatatctggacagctatgaacgatatgccttcaatcgtccaaacactagtcaagta
gcgaatgcgatcaattcaggaaggagtctgccatga

DBGET integrated database retrieval system