KEGG   Moniliophthora roreri: Moror_4374Help
Entry
Moror_4374        CDS       T03137                                 

Definition
(RefSeq) glucan -alpha-maltohexaosidase precursor
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mrr  Moniliophthora roreri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Moror_4374
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Moror_4374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 509 aa AA seqDB search
MSVDANVAYSSAKEQNYTMIQAFEWYSKGGGAHWKKLASKVPELASLGITAMWIPPPTKA
AGQESVGYDTYDLYDLGEFAQKGGIPTKYGTKEELVEMVKKAKEAGIVTYVDAVLNHKFG
ADKTETFGVIEVDNNDRTKEISDLYNITGWTGFEFPGRGNKYSEFKWSFNHFTGVDFDEN
TKKKAIFRIQGNGKYWASGVDNENQNYDYLMGADIDHSHPKAREDIINWGKWIINEIGAA
GFRFDAVKHIDSGFIAEFIKSVRQNTDKPKMFAVGEFWKDSLEDLEAYLGSLGTQFSVFD
APLHYNFKEAGDRANGYDLRAIWDGTVVQKRPIDAVTLVDNHDTQIGQALESWVSPVFKP
LAYAMILLRPDGYPCVFWGDLYGTEGPEGNPQQPVSQLGDLIRARKLFAYGELRDYWDHM
NCVGWVRMGDEMNGRDGCAVVLCNGDEEGTKRMEVGKEHAGEKWTDLLGWCQGEAVIGED
GWAEFKCSARSVSVWIRECAKGREEFEKH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgacgcgaacgtcgcttattcctctgcaaaagagcagaattacacgatgatt
caggcattcgaatggtattctaaaggcgggggcgcgcattggaagaagctggccagcaaa
gtaccggagctcgcgtcacttggaataacggcgatgtggatacccccacctacgaaagct
gcaggccaagaatcagtaggctacgacacctacgatctttacgatctgggcgagttcgcc
caaaagggcgggataccaaccaaatacggtaccaaggaagaactcgtcgagatggtgaag
aaggctaaagaagcagggatcgtgacctatgttgacgctgtattgaaccacaaatttggg
gccgacaagacagaaacctttggagtaattgaagtagacaataacgaccgcaccaaagaa
atctctgatttgtacaatatcacgggctggaccgggttcgaattccctggtagaggtaac
aaatacagcgaattcaagtggagttttaaccacttcaccggcgtggacttcgacgagaat
acaaaaaagaaagccatctttcgcatccaaggcaatggtaagtattgggccagcggtgtc
gataacgagaatcagaactacgactacctcatgggcgccgatatcgaccattcgcacccc
aaagctcgcgaagatatcatcaactggggcaagtggatcatcaacgaaattggtgcagca
gggtttcggtttgacgccgtcaagcatatcgatagtggatttatagccgaattcatcaag
tctgttcgtcaaaatacggataagcccaagatgtttgccgtcggagagttttggaaggat
tcgttggaagacttggaagcatatctaggctcgttgggtacgcagtttagcgtgtttgac
gcgccattgcactacaacttcaaggaggcaggagatcgtgccaatggctatgatctccgt
gcaatctgggatggaacggttgttcagaagaggccgattgatgcggtgactctggtcgat
aatcatgacactcaaatcggtcaagccctcgagagctgggtctcacctgtcttcaaaccc
cttgcatacgctatgattctcctcagacctgatggttatccatgcgtgttctggggcgat
ctctacggaacagaaggacccgaaggcaacccacaacagccggtttctcagctaggcgat
ctgattcgtgcgaggaagctctttgcgtatggtgaactgagggattactgggaccatatg
aactgtgtcggctgggttagaatgggtgacgagatgaatggaagagatggctgcgcggtg
gtgttatgcaacggcgatgaagaaggaacgaagaggatggaagtaggcaaggagcatgca
ggagaaaagtggacagatctcttgggctggtgtcaaggagaggctgtgattggtgaagat
ggttgggcagagttcaagtgctcggctcgaagcgtcagcgtttggatcagggagtgcgct
aaaggtagagaagaatttgaaaagcattga

DBGET integrated database retrieval system