KEGG   Moniliophthora roreri: Moror_7801Help
Entry
Moror_7801        CDS       T03137                                 

Definition
(RefSeq) histone deacetylase 8
  KO
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
mrr  Moniliophthora roreri
Brite
Enzymes [BR:mrr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Moror_7801
Chromosome [BR:mrr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Moror_7801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 385 aa AA seqDB search
MSDSRALIAYIVSNELVKHSSLLPSNPNRSLLVHTLIKDFDLLSQSYSNKRRILVIKPHI
ASYQDLVAYHSKDYLDFILNGNEEGSPAEFGLEDDCPVFPGLKEYVCCVAGATLTAVNAL
KVPNVEVAICWDGGRHHAQRGRASGFCYVADCVLAILLLKRLPPCPKDTESTFPARKARV
MYIDLDVHFSDGVSHAFYQPHSSMVRHVLTLSIHHSSPGYFPISPLSSQSTVDPYTISIP
LEHGLSSKTYLAIWPYVERIRDAFDPDYVVVQCGVDGLAGDPGAGRVGNWCLGGEGSLGW
CVQRILETWRGKKLLLGGGGYHSPNAARAWAYLTSISLANPLPLDTPIPHTHDAFPEYAP
SFELDVPASNMEDRNWSIPKDPNAE
NT seq 1156 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattcacgcgcgttgatcgcctatatcgtctcaaacgagctagtcaaacactct
tccttactcccgtcaaatccaaaccggtctttgctcgttcataccctcatcaaagacttc
gatctcttgagccaaagctattctaacaaacgaagaattctcgtcataaaacctcatatc
gcaagttaccaggatctagtcgcgtatcactcaaaggattatctggatttcattctaaat
gggaacgaagaggggtctccagcagaatttggactggaggatgactgcccagtatttcca
ggattgaaggagtacgtgtgctgtgtagcaggagcaactcttaccgcagtaaatgcgttg
aaagtgccgaatgtggaagtagccatttgctgggatggtggaagacaccatgctcaaaga
ggtcgtgcatctggtttttgctatgttgcagactgcgtcctcgcgattcttttgctcaaa
cgcctccccccgtgccccaaggataccgaatccacttttccagcgagaaaggctcgtgtg
atgtacattgacctagacgtgcacttttcagacggtgtttcgcatgcattctaccaacct
cattcaagtatggttcgtcacgtcctcacactcagcatccaccactcatcgcccggatat
tttcccatctctcctctttcctctcagtcgacggttgacccatacacaatctccatccct
ctcgaacacggtctctcttccaaaacatacctggccatttggccatatgtcgaacgaatc
agggatgctttcgatcctgactacgttgtggtacaatgtggtgtcgacggcttagcaggc
gacccaggcgctggtcgggtaggaaactggtgtctcggtggtgaaggctccttgggttgg
tgcgtccagcggatattagagacgtggagaggaaagaagctactcttgggtggcggaggc
tatcattcaccaaatgcagctagagcatgggcgtatttgacttcaatttcgcttgccaac
ccactaccattggacacgcctatcccgcatactcatgatgcttttcctgaatacgcaccg
tctttcgagttagatgtaccagctagtaatatggaggaccgcaattggtcgatcccgaaa
gatcccaatgcagaat

DBGET integrated database retrieval system