KEGG   Mycobacterium sp. JS623: Mycsm_04376Help
Entry
Mycsm_04376       CDS       T02423                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4312590..4314371
Genome map
AA seq 593 aa AA seqDB search
MRGAPPVRVKHQTLNDMLAAAAQTRVSLVFVNRKEQDLHVPMARIRERALSIAADLRSRG
VRKGDRVALVLPTCPEFVECLFGVLCAGAVPVPLYPPMRLGRLDEYHRSTAAMLRAVNAA
MVVTDERIRRFLGVAVDISEPRLGCVTASSLGGTNSVEVEVAADDLALIQFSSGTTNDPK
PVALTHANLLSNLAAINHYLTDNGAPRPVGVTWLPLYHDMGLIGNLLSAFYLPGPLVLLA
PELFVAVPGAWLRAISRHQGTVSAAPNFAFGLCLKRIRDEELQGVDLSSWTVSLNGAEAV
SAGLQRRFNERFERWGLRASALTPCYGMAEASLGVTFKPAGTVFRTLGVDADKLAVEGIV
APGNKELVSVGRPLAGVQVEIRDAAGVALPSGRTGHVFVRGPSVMVGYFGRTDLTDQALH
DGWLDSGDLGFTHEGELFLCGRHKDIVVVRGANHAPEEFEAALDGLPGVRIGCAVAVGFV
PVGEDDEALAMLVETTTDAAATLADEVALRVQERTQIRPAHVELVAPGTLPRTSSGKLRR
REARTQWLSGTLSPPKKVSAARLLVAAARGELRHTRARLARRAANAPSVTTEQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcgctcccccggtccgggtcaagcaccagacgctgaacgacatgctcgccgcg
gctgcacagactcgcgtcagcctggtcttcgtcaaccgcaaagagcaagacctgcacgtc
ccgatggctcgtatccgggagcgtgcgctctcgatcgctgcggatctgcggagccgtggg
gtacgcaagggcgatcgcgtggcgctcgtgctgccgacctgtccagagttcgtggagtgt
ttattcggcgtgctgtgcgccggcgccgtcccagttccgctatatccgcccatgcggctc
ggccggctcgacgagtatcaccgcagcaccgcggccatgctgcgggcggtgaacgcggcc
atggtggtgacagacgaacgcatccgccggttcctcggtgtcgccgttgacatttcagaa
ccgcgcctgggttgtgtgaccgcgtccagtctggggggcaccaactccgtcgaggtcgag
gtcgcggccgacgacttggcgttaatccaattctcgtcgggcacgacgaatgatcccaag
ccggtggccctgacccatgcgaatctgctgtccaacctcgcggcgatcaaccactacctc
accgacaatggcgcgccgaggccggtcggcgtcacgtggctgcctctgtaccacgatatg
gggttgatcggcaatctgttgtccgcgttctaccttcctggtccgctcgtgctacttgcg
cccgagctgtttgtcgcggtgcccggtgcgtggctgcgggccatctcgcgacatcaggga
accgtctcggcggcacccaatttcgcgttcggcctatgcctcaaacgtatccgcgacgag
gagctccagggcgtcgacctgtcgtcgtggacggtctcgctcaatggagccgaggcggtc
agcgcggggctgcagcgacgattcaatgaacgattcgagcgctggggcctgcgcgcttcg
gcgcttacgccttgctacgggatggccgaggcctcattgggggtgacgttcaaacccgcg
ggcaccgtgtttcgcacccttggcgtggacgccgacaaattggctgtggaaggcattgtg
gcgccaggaaataaagagctggtaagtgtgggccgcccgctggccggtgtgcaggtcgag
atccgtgacgcggccggggtggcactgccttccggccgcactggtcacgtctttgttcgc
gggcccagcgtgatggtgggctacttcggccggaccgacctgacggatcaggcgctacac
gacggttggctggactccggcgatctcgggttcacccacgaaggcgagctctttttgtgc
ggacgacataaggacatcgtcgtcgtacgcggcgccaaccacgcgcccgaggaattcgag
gcagcgctggatgggctgcccggtgtgcggatcggatgtgccgtcgccgtgggattcgtc
cctgtcggcgaggacgacgaggcgctggccatgctcgtcgagaccactacagacgcggcc
gcgacactggcagatgaggtagcgctgcgagtgcaggagcgcacgcaaatccggcctgcg
catgtggaattggtggcaccgggcacgctgccacgcacaagcagcggaaagctccgacgg
cgcgaggcgcgcacccagtggctgtcaggcaccctgtcgcctcccaagaaggtttctgcc
gcaaggctattggtggcggccgcccgcggggaactgcgccatacccgcgcgagactggca
cgacgggcggcaaacgcgccgtcggttaccaccgagcaatag

DBGET integrated database retrieval system