KEGG   Methylocystis sp. SC2: BN69_0729Help
Entry
BN69_0729         CDS       T02324                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
msc  Methylocystis sp. SC2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
789420..792266
Genome map
AA seq 948 aa AA seqDB search
MPEAKPGLERASMRSVEDAQEIVLEVVRGLVIELHPDMVESRLVQLDSDLDRDLALDSLT
RAELLLRLNRKFKVQLSERLLGEVSRPRDLLNAVLAAGAAVAPATTHPAPHLTLESVDEP
LEAKTLVEALARHAERHGARENVLLWRAEGPPEPLTYHDLYHAARAAAGGLIERGAGSGD
RIAIMLPTSRDFFVAFFAVLFCGAVPVPIYPPFRLSQIEDHLRRQAGILSNAEACALITN
DEIRIVGRLLYGLVGALQHIVTIPELSSAAPLPAPLPSPPDATALIQFTSGSTGDPKGVV
LTHANLLANIRAMGAVLKASSADRVVSWLPLYHDMGLIGCWLGSLYYGAPALIMSPLSFL
VDPARWLWAIDAHKATISAAPNFAYELCLKAIDDTKIANLDLSSLRAILNGAEPVSPTSI
ARFVQRFSAYGFQHQMMTPVYGLAENAVGLAFPPLGRGPLIDRVDRKALDRDGVARAAGA
SGGDVISLVACGRPLPHHEIRIVDDSSRELPERQEGRIQFRGPSATRGYFQNPEKTRALF
DGDWLETGDRGYVAGGDVFVTGRIKDLIKRAGRNIYPQELEEAVGSLEGTRKGCVAVFPA
LDARAGTERLIVLAETRLIEDAKRESLRKMIVETSQALLDLAPDEVVLVPPHTIPKTSSG
KIRRSAARAMFESGRLRVKSESPRLQLVRVALAGAAPRLRKALANLATSAYNGYAWSVLA
FIGVCVWPCVLATPKRSWRHRLVSAAARSFFRMIGCPLSVTHDAPLPQDNAILVANHSSY
LDSAVLVAVCAGELSFIAKEELAHQRVAGPFLRRLGAIFVRRSDPAGGVADAREALKSAR
AGVRLVWFPEGTFSRMPGLLGFHIGAFSSAAQLGLPIVPITIRGTRSILRSDSWLFRRGP
IAVHIGAPIAPEGDDFQAAIALRDAARQRILERCGEPDLGHERVALTG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggcgaaaccaggccttgagcgggcgtcgatgcgctccgtggaagacgcccag
gagatcgttcttgaggtcgtccgcggtctcgtcatcgagttgcatccggatatggtcgag
tcgcgtctcgtgcagctcgacagcgaccttgatcgcgatttggcgctggatagcctgacc
cgcgccgagctgttgctgcggctcaaccgcaaattcaaggtgcagctctccgaacggctc
ctcggcgaggtcagccgtccccgcgatctcctcaacgccgttcttgcggccggcgccgcg
gtcgcccccgcgacgactcatccggctccccatttgacgctcgagtccgtggacgaaccg
ctcgaggccaaaacgctggtcgaggcgctggctcgacacgcagagcggcacggggcgcgc
gaaaatgttctgctttggcgcgctgaagggcctccggagcctttgacgtatcatgacctc
tatcacgccgcccgggccgcggctggcggcctcatcgaacgaggcgctggctctggcgac
cgcatcgcaatcatgttgccgacgagccgtgatttcttcgtcgcctttttcgcggttttg
ttctgcggcgccgttcccgttccgatttacccgccatttcgtctctcgcagatcgaggat
catctgcgccgccaggccggcatattgtcgaacgctgaggcctgtgcgctgatcacgaac
gacgagatcagaattgtcggtcgcttgctctacgggctggtcggcgcgcttcagcacatc
gtgacgattcctgagctgagctctgcggcgcctttgcccgcgccattgccgtcgccgccc
gacgcgacggcgctcattcaattcacctcgggcagcacgggcgatccgaagggcgtcgtg
ctgacgcacgccaatcttctcgccaatattcgcgccatgggcgccgtgttgaaggcctcg
tcggcggatcgggtcgtcagttggctgccgctctatcacgacatggggctgatcggttgc
tggctgggcagcctctactatggagcgcccgcgctgatcatgtcgccgctgtcttttctc
gttgatccggcccgttggctgtgggcgatcgacgctcataaggcgacgatctcggcggcg
ccgaattttgcgtacgaactctgtctgaaggccatcgacgatacgaagatcgccaatctc
gatctttcttcgctgcgtgcgatcttgaacggcgccgaaccggtgagcccgacctcaatt
gcgcgctttgtacaacggttttcggcttatggctttcagcatcagatgatgactcccgtc
tacggcctcgcggaaaatgcggtggggctcgcctttccgccgctcggcagaggaccgctc
atcgatcgcgtcgatcggaaagcgctcgatcgggacggcgtggcgcgcgcggcgggcgcc
agcggcggggatgtcatttccttagtcgcctgcgggcgccctctgccgcatcacgagatc
cgcatcgtcgatgactccagtcgcgaattgcctgaacgccaggagggacgcatccagttt
cgcgggccatctgcaacgcgaggatatttccaaaatccggaaaagactcgcgcgctgttc
gatggcgattggctcgagacgggcgaccgcggctatgtcgccggcggcgacgtcttcgtc
accggccgcatcaaggatttgatcaagcgcgcagggcgcaacatctatccgcaggagctc
gaagaggctgtcgggtcgctcgaagggacgagaaaaggctgcgtcgcggtgtttcccgcg
ctcgacgcgcgcgccgggacggaacgactcatcgtgttggccgaaacgcgcctgatcgaa
gacgcgaaacgggaatcgctgcgcaaaatgatcgtcgagacgtcccaagccttgcttgat
ctcgcgccggatgaagtcgtcctcgttccgccgcacactatcccgaagacttcgagcggc
aagatacggcgctcggcggcgcgcgccatgttcgaatccggtcggctgcgcgtgaaaagc
gagagcccacgattgcagcttgtccgcgtcgcccttgcgggcgccgcgccgcggctgcgc
aaagccctcgccaacctcgcgacctcggcatacaacggctatgcgtggagcgtgctggcg
ttcattggcgtttgcgtgtggccatgcgtgctggcgacgccaaagcggtcatggcgtcac
cgccttgtcagcgcggcggctcgatcttttttccgcatgatcggatgccccctctcggtc
acgcacgacgcgccgctcccgcaagacaatgcgatcctcgtcgccaatcattccagctac
ctggacagcgcggtgctggtcgccgtctgtgcgggagagctctccttcattgcgaaggaa
gagcttgcgcatcagcgcgtcgccggtcccttcctgcggcgactcggcgcgattttcgtt
cgccgctctgatccggcaggcggcgtcgccgacgccagggaagccttgaagtcggcgcgc
gccggcgtgcgtctggtctggtttccggagggcaccttttcgcgcatgccgggactgctg
gggtttcatatcggcgcgttttccagcgccgcgcagttggggcttccaattgtgccgatc
accatacgcggcacgcgctcgattttgcgcagcgattcatggctgttcaggcgaggcccg
atcgccgtgcatatcggcgcgccgatcgcgcccgagggcgacgatttccaggcggcgatc
gctttgcgcgacgccgcccgccaaagaatattggagcgctgcggcgaacctgacctcggt
cacgaacgtgtggcgttgacgggatga

DBGET integrated database retrieval system