KEGG   Methylocystis sp. SC2: BN69_1801Help
Entry
BN69_1801         CDS       T02324                                 

Definition
(GenBank) Glutathione S-transferase domain
Organism
msc  Methylocystis sp. SC2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_11 GST_N WYL GST_N_3 GST_N_2 GST_C_2 GST_C HTH_20 HTH_IclR GST_C_3 CENP-P
Motif
Other DBs
NCBI-ProteinID: CCJ07252
UniProt: J7Q8R8
LinkDB All DBs
Position
1863492..1864862
Genome map
AA seq 456 aa AA seqDB search
MARTHRLFELLQMLRRRRRPVSGAELAREAGVSLRTLYRDIAALQAMGAEIDGEPGVGYV
LRPGFLLPPLMFSEEEIEALALGAKWVARRTDDALSEAAGNAVAKISAVLPRELRTRLED
DALLVGPGWERPQHVELTLLRRALREERKFAISYRDEKGARTRRVIWPVALGFFESVRVL
VGWCELRRAFRHFRTDRVEAAHILDARPPRRRQTLVREWRQTMLTEADSVIAYSRSASGK
PKGESMAKELVFYTNPQSRGMIAHWMLEEVGAPYSIEVKDYGTTMKAPEYLAINPMGKVP
AVRHGETVVTEAAAICTYLADAFPEAGLAPEAGARGDYYRWLFFAAGCVEPAMSNHAAGW
DPATPEMQARFGYGSYAAVMDAVAKAVAGRRYIAGDRFTAADVYVGSMIGFGLRFGVIDK
RPEFEAYWSGLENRPARLRAGAEAEKLASKQAWVPA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcacccatcggctgttcgaactcctgcaaatgttacgacggcgccgccggccg
gtgagcggggcggagttggcgcgcgaagcgggcgtctccttgcgcacgctctatcgcgac
atcgccgctttgcaggcgatgggagcggaaatcgacggcgaaccgggcgtcggctatgtg
ctgcgtcccggctttctcctgccgcccctgatgttttcggaggaggaaatcgaggcgctg
gcgcttggcgcgaaatgggtggcgcgccgcaccgacgacgcgctgtccgaggccgccggc
aacgcagtggcgaaaatctcggcggttttgccgcgagagcttaggacccgtttggaagac
gacgcgctgctggtcggcccaggctgggagcggccacagcatgtcgaactaacgctgttg
cgccgcgcgttgcgcgaagagcgcaagttcgccatttcctatcgcgatgaaaaaggcgcg
cggacgcggcgcgtcatttggcccgtagcgctcggctttttcgaatccgtccgcgttctc
gtcggctggtgcgagttgcggcgcgcctttcgacacttccgaaccgatcgggtcgaggcg
gcgcatatcctggacgcgcgcccgccgcgccgccgtcagacgttggtgagagaatggcgt
caaaccatgctgacagaagctgacagcgtcatcgcttacagtcgctccgcatcaggaaag
ccgaagggagaatccatggcgaaggagcttgttttctacaccaatccgcaatcgcgcggc
atgatcgcgcactggatgctggaagaggtcggcgcgccctattcgatcgaggtcaaggat
tacggaacgacgatgaaggcgcccgaatatctcgcgatcaatcccatgggcaaggtgccg
gccgtccggcatggggagacggtggtgaccgaggcggccgccatctgcacctatctcgcc
gacgcctttccggaggccgggctcgcgccggaggccggggcgcgcggcgactattatcgc
tggctcttttttgccgcaggctgcgtcgagccggcgatgagcaaccacgccgccggttgg
gaccctgcgacgccggagatgcaggcccgctttggttacggctcctatgccgccgtgatg
gacgcggtggccaaggctgtggcaggacgtcgctatattgcgggcgacaggttcaccgcc
gcagacgtttatgtggggtcgatgatcggctttgggctgcgattcggcgtgatcgataag
cgtccggaattcgaagcctattggagcggcttggaaaatcgcccagcgcggctgcgcgcc
ggcgccgaggccgagaagctggcgtcgaaacaagcctgggtaccggcgtga

DBGET integrated database retrieval system