KEGG   Myxococcus stipitatus: MYSTI_02064Help
Entry
MYSTI_02064       CDS       T02436                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
msd  Myxococcus stipitatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding
Motif
Other DBs
NCBI-ProteinID: AGC43393
UniProt: L7U5K8
LinkDB All DBs
Position
complement(2549187..2552738)
Genome map
AA seq 1183 aa AA seqDB search
MSDSNPLFSSSSMTELALRRAAEHPDLRAYTFLVDGEEEELHFTYAELDQRARTIAGFLQ
SQGAQGERVLLLYPPGLDYVSAFVGCLYAGAIAVPAYPPDPMRLSRTLPRLEALIADADA
RFALTTEFIQGMSGALGEQSPRLAALAWVATDTLDDRAASAWKAPSLSPESPAFIQYTSG
STGTPRGVMLSHRNLLHNSAAIHRCFEHSADSKGVIWLPPYHDMGLIGGVLQPLAGGFPV
VLMSPLDFLRKPLRWLQAISRHRGTTSGGPNFAFDLCLRKTTPEQRAALDLSCWDVAFNG
AEPVRADTLTRFAELFAPSGFRKEAFYPCYGLAEGTLISSGGRKSALPVVRTFEQAALLK
GDAVEVSAEAPPSDEAQPHVGCGVSVLDQELLIADPDSGVPVPPGRVGEIWVSGQSVAQG
YWRQPELSEHTFRARRGDTGAGAWLRTGDLGFLRDGELFVTGRIKDLIILRGRNLYPQDL
ERSLEGLHPALRPGCCAAFSVDTGGEERLVLVHEVDPGKLPEPDALVDALRQVLAQKHEV
HLHGVALIAPGSIPKTSSGKIQRRACRAMYLGGELEVITRSDASEHVAASEPAAELPVLS
REVLLAAPREERPRLLAEHLRHLVSRALDVAPSSLDADRPLAAFGLDSMHSIELKSALED
GLGVSLPVAVLLDGAGLRQLTQKVLEELDAPTSTLPPLEPVARGAHVPLSFAQERLLFLD
QLSSGNSAYNIPVSVLLEGRLDLGALGRSLSTILARHEALRARYPWVDGRRVQVIAPTDS
PATADPFASADAVIDLSGMPEAEHAAAVARLTAEEARRMFDLTTGPLVRVRLLRMSAERH
HLLLNIHHIVSDGWSMGVLVRELGALYAAFVEGKPSPLPAMPLQYADYAVWQRRWLESGG
LESEAAWWKSQLTGAPALLELPTDRPRPASQSFLGARHHLEFSPTLTSSLKALGQAEGAT
LYMTLLAGFLVTLHERTGREDVVVGTDVANREHAKAQGLIGLFVNQLVLRADLSGNPTFQ
QLLGRVRELALGAYAHPHLPFDKLVETLRPPRDPRYNPLFQVMFVLENAPLPKLVLPGLS
LRILEVDDGGSPFDLSVLLSESAGGLGGVLRYSTALFDAVTMSRLADAYGAVLSAVAEQP
HVTLAELRGVISEQERRRQAAQAEALKAVRSEKFRNTRRKSEN
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactccaatccgctgttctcatcttcgagcatgaccgagctggcgctccgccgc
gccgcggagcacccggacctgcgcgcctataccttcctcgtggatggggaggaggaagag
ctccacttcacctacgcggagctggaccagcgggcgcgcaccatcgcgggcttcctccag
agccagggcgcgcagggcgagcgcgtcctgctgctctatccgccggggctcgactacgtc
tccgccttcgtcgggtgtctctatgcgggcgccatcgccgtgcccgcctatccaccggac
ccgatgcggctgtcgcggaccctgccccggctggaggcgctcatcgcggatgcggacgca
cgcttcgcgctgacgacggagttcatccaaggcatgtccggcgcgctgggtgagcagtca
ccccggctggccgcgctcgcgtgggtggccacggacacactggatgaccgcgcggcctcg
gcgtggaaggcgccctcgctgtcgccggagtcaccggccttcatccagtacacgtccggc
tccacggggacgccgcgcggggtgatgctgtcgcaccgcaacctgctccacaactcggcg
gccatccaccgctgcttcgagcactcggcggacagcaagggcgtcatctggctgccgccc
taccacgacatgggcctcatcggcggggtgctccagccgctcgcgggcggcttccccgtc
gtgctcatgtcgccgttggacttcctgcgcaagccgctgcgctggctgcaggccatctcc
cggcaccgaggcaccacgagcggcgggcccaatttcgccttcgacctctgcctgcgcaag
acgacgcccgagcagcgcgcggccctggacctgagctgctgggacgtggccttcaacggc
gcggagcccgtgcgcgccgacaccctcacccgcttcgcggagctgttcgcgccgagcggc
ttccgcaaggaggcgttctacccctgctacggcctggccgaagggacgttgatctcctcc
ggcggccgcaagtccgcgctgcccgtggtgcggacgttcgagcaggccgcgctgctcaag
ggcgacgccgtggaggtctccgccgaagcgccgccgagcgacgaggcgcagccgcacgtg
ggctgcggcgtgagcgtgctggaccaggagttgctcatcgccgaccccgactccggcgtg
cccgtgccgccgggccgcgtgggggaaatctgggtcagcggccagagcgtcgcgcagggc
tactggcgacagccggagctgagcgagcacaccttccgggcccgccggggcgacaccggc
gcgggcgcctggctgcgcaccggagacctggggttcctgcgagacggtgagctgttcgtc
accggccgcatcaaggacctcatcatcctccgaggccgcaacctgtatccgcaggacctc
gagcggagcctcgagggactccaccccgcccttcgccccggctgctgcgcggcgttctcc
gtggacacgggcggcgaggagcgcctggtgctcgtccacgaggtggaccccggcaagctg
ccggagcccgacgccctggtcgatgcgctgcggcaggtgctcgcgcagaagcacgaggtg
cacctgcacggcgtcgccctcatcgcgcccggcagcatccccaagacgtccagcgggaag
attcagcgccgcgcgtgccgcgccatgtacctggggggggagctggaggtcatcacccgg
agcgacgcctcggagcacgtcgcggcctcggagcccgccgccgagcttcccgtcctgagt
cgcgaggtgctgctcgccgccccgcgcgaggagcgtccccggctgctcgccgagcacctg
cgccacctggtctcccgcgcgctcgatgtcgcgccctcctcgctggacgcggaccggcct
ctcgccgcgttcggcctggactcgatgcactccatcgagctcaagagcgcgctggaggac
gggctgggcgtgagcctgcccgtcgccgtcctgctcgatggcgcgggcctgcggcagctc
acccagaaggtgctggaggagctcgacgcgcccacctccacgctgccgcccctggagccc
gtggcgcgcggcgcccacgtcccgctctccttcgcgcaggagcggctgctcttcctggac
cagctctcctcggggaactccgcctacaacatccccgtgtcggtgctgctggaagggcgc
ctggacctcggggcgctcggacgcagcctctccaccatcctggcgcgccacgaggcgctc
cgggcccgctatccctgggtcgacggccggcgggtgcaggtgattgcgcccacggactcc
ccggccacggccgaccccttcgcctcggcggacgcggtcatcgacctgtcggggatgccc
gaggcggagcacgcggcggcggtcgcccgcctcaccgccgaggaggcccggcgcatgttc
gacctgaccaccgggccgctcgtgcgcgtgcggctgctgcggatgagcgcggagcggcac
cacctgctgctcaacatccaccacatcgtctcggacgggtggtccatgggggtgctcgtc
cgcgagctgggcgcgctctacgccgccttcgtcgagggcaagccgtccccccttcccgcc
atgccgctccagtacgcggactacgccgtgtggcagcgccgctggctggagtccggtggc
ctggagtccgaggccgcgtggtggaagtcccagctcaccggcgcgcccgcgctgctggag
ctgcccacggaccggcctcggcccgcgagccagagcttcctgggcgcgcggcatcacctg
gagttctcgcccacgctcacctcgtcgctcaaggcactggggcaggcggagggcgccacg
ctctacatgacgctgctcgcgggcttcctcgtgacgctccacgagcgcacgggccgcgag
gacgtcgtcgtcggcacggacgtggccaaccgcgagcacgcgaaggcgcaggggctcatc
gggctcttcgtgaaccagctcgtgctgcgcgcggacctctccggcaaccccacgttccag
cagctcctggggcgcgtgcgggagctggcgctgggcgcctacgcgcatccgcacctgccc
ttcgacaagctggtggagacgctgcggcctccgagagacccccgctacaacccgctgttc
caggtgatgttcgtcctggagaacgcgccgctgcccaagctcgtgctccccgggctctcc
ctgcgcatcctggaggtcgacgacgggggctcgcccttcgacctgtccgtcctcctctcc
gagagcgcgggagggctcggcggcgtgctgcgctacagcaccgccctgttcgacgccgtc
accatgtcgcgcctggcggacgcctacggggccgtgctgtcagcggtggccgagcagccc
cacgtcaccctcgcggagcttcgcggcgtcatctccgagcaggagcggcggcggcaggcg
gcccaggcggaagcgctgaaggcggtccgctcggagaagttccgcaacacccgccgaaag
tccgagaactga

DBGET integrated database retrieval system