KEGG   Myxococcus stipitatus: MYSTI_03916Help
Entry
MYSTI_03916       CDS       T02436                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
msd  Myxococcus stipitatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGC45222
UniProt: L7UC95
LinkDB All DBs
Position
4958188..4963512
Genome map
AA seq 1774 aa AA seqDB search
MHLPTRVSPASAFVRPESTTLVEVCRYRAVTQPTDDIYTFVDETGEHTVTYAQLDTEVRA
VAARLQRELAPGDRALLMYPPGREYVVGFLACLYAGVVAVPAYPPDVTRLGRTLPRLLAL
VADCGARVALTTEGIASLVGPLTEGREDLRALRWLATDGVPVEEAASWRELDLRPDTVAF
LQYTSGSTGTPRGVVLGHRQLLHNSELISRGFNAKPDPRFVSWLPPYHDMGLIAGIIHPL
FRDMPSSLMPPLYFLQRPMRWLEVISRHGGTVSGGPNFAFDLCVRKSTPEERAALDLSRW
EVAYCGAEPVRAETMERFAQAFAPGGFRRQALYPCYGLAEGTLIVTGRQRAEDREDVLVV
RDYSREGLERGEARPPSPGEEGAALVSCGEVLGVQEVRVVDPGTREVVPAGRVGELWVRG
PSVAEGYWQRPEETERDFNGRLAGSAEGPFLRTGDLAIVEDGEVFITGRLKDVLILRGRN
LYPQDLELTVERSHPALRPGCGVAFPVQVHGEERLVVVQEVAAKAVEGGAVDDALARIQA
ALTEEHGVAAHAVVLITAGSLPKTSSGKVQRRVTRRTYLDGALEVVKAWRESDVDSRDAE
SVSPESDEVLGWLAGDVAWRLGSSAEALDADAPLTRYGLDSLRGLDVMHAIQRRWGVSLP
PTFLLQGPSLREVAAKVEQERGAAVQPVSSSTPALGDVSPHVSDGQRALWFLQRLAPGGT
AYHIARAMRLAPDVDLEVLARVFAELAARHPALACAFPEERGEPVWRSAAAPVMERESAS
GWSDAALRERLDAESQRPFDLEHGPLMRVRVFTGVETGPVLLLVFHHLITDFWSLEVLAE
ELGVLYTAGVRGVPAELPPPPPMAGPILREREARLTGARGEALQSWWRERLGGELPVLEL
PTSKPRPRLQSFRGAAVSFQVEADTASRLLSLAGTHGATPFMVLLAGYVAFLRRYTGQED
LVVGTPTTGRAHADLSRQLSYFVNPVALRARVPRGQSFTSLLKEVRGLVLEALEHQELPF
ARMVERLQPRRDAARAPVFQTMFVLHAGRPGREALAPFALGGAGTRVRLGALELESVPLR
NQASAFDLTLTMAESEGGFAASLEYCTDLFDAALAERMVRHFRTLLDAAAREPEVPVLDL
PLLEGEEQRVLLAAGRRATASEEPSARSLHGAFEAAVARSPDAVALVSGTSRWTYGEVDA
WAERLGARLRQRGVGPEVRVGVLLERGHPGTVIAFLAVLKAGGTVVPCEPSHPPERIAWM
LRDAGARGLLVQERLSRRLDLSSDVLRLLWEELGGHEPRAEDVRTDAPSFPSPECSAYVI
YTSGSTGRPKGVVVTHRGALHLAESMGRGFGLGAGDRVLQFASPAFDASIAEYLQALLTG
AALHLPPSGELLAGEALHRVLKEERITLVTLPPSACALLPEAPLPDLRRLVSAGESCPED
LVSRFAPGRTFVNAYGPTEATVCSTWAICQPGEGTPDIGRPLPAVDAYVLDEALNPVPRG
VAGELCVGGPMVARGYLGRPDLTAERFVPDPHGGAPGGRLYRTGDVARWRPDGRLELLGR
VDAQVKLRGFRIEPGEVEAVLRELARMRQAHVRVWRPPSGGEARLVAYVVPPEEGLPPPG
ELKASLRARLPEYLVPADFVALEALPLLSSGKVDVRALPPPMRMAPAEGAPRTPLEEALS
RAWAETLGFPAVGVHSHFFDDLGGSSLAAVRACARIRESLGRDVPITHFFEHPTVHALAR
RLSSDSEPGTQAVKHQERAEARRQVLQRRGGRNT
NT seq 5325 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgccgactcgcgtttcccccgcatccgcgttcgtccgtccggagtccaccacg
ctcgtggaggtgtgccgctaccgcgcggtgactcaacccacggacgacatctacaccttc
gtggatgagacgggggagcacaccgtcacctatgcccagctggacaccgaggtgcgcgcg
gtggcggcgcgccttcaacgcgagctggccccgggagaccgcgcgctgctcatgtacccg
ccgggtcgcgagtacgtcgtgggcttcctcgcgtgcctctacgcgggcgtggtggcggtg
cccgcgtatcccccggacgtgacgcgcctggggcgtacgctgcccaggctcctggcgctg
gtggcggactgtggcgcgcgagtggcgctcaccacggaaggcatcgcctcgctggtgggg
ccactcacggaggggcgcgaggacctgcgcgcgctgcgctggctcgcgacggacggcgtg
cccgtggaggaggccgcgtcgtggcgcgagctcgacctgcgccccgacacggtggcgttc
ctccagtacacctccggctccacggggacgcctcgcggcgtggtgctggggcaccggcag
ctgctgcacaactcggagctcatctcccggggcttcaacgcgaagccggatccgcggttc
gtctcctggctgccgccgtaccacgacatggggttgatcgccggcatcatccacccgctg
ttccgcgacatgccgtcgtcgctgatgccgcccctgtacttcctccagcgtcccatgcgc
tggctggaggtcatctcccgccatggcggcacggtgagtggcggacccaacttcgcgttc
gacctctgcgtgcgcaagagcacgccggaggagcgcgccgcgttggacctgagccggtgg
gaggtcgcgtactgcggcgcggagccggtgcgcgcggagacgatggagcgcttcgcccag
gccttcgcgcccggggggttccggcgtcaggcgctctatccctgctacgggctcgcggag
gggacgctcatcgtcacgggccgccagcgcgcggaggaccgcgaggacgtgctcgtggtg
cgcgactactcgcgcgaggggctggagcgaggcgaggcgcgaccgccgtctcccggtgaa
gaaggcgccgcgctggtgagctgtggcgaggtgctgggcgtgcaggaggtccgcgtggtg
gacccgggcacgcgcgaggtggtgcccgcggggcgcgtgggcgagctgtgggtgcgtggc
cccagcgtcgcggaggggtactggcagcggcccgaggagaccgagcgcgacttcaacggc
cgactcgcgggctcggccgagggccccttcctgcgcacgggcgacctggccatcgtcgag
gacggcgaggtcttcatcaccggccgactgaaggacgtgctcatccttcgcgggcgcaac
ctctacccgcaggacctggagctgacggtggagcggagccacccggccttgcggcccggc
tgtggcgtcgcgttcccggtgcaggtgcatggcgaggagcggctcgtcgtggtccaggag
gtggccgcgaaggcggtggaggggggcgccgtcgatgacgcgctcgcgcgcatccaggcc
gcgctgacggaggagcacggcgtcgccgcgcatgcggtggtgctcatcaccgcggggagc
ttgccgaagacctcgagcggaaaggtccagcggcgggtgacgcggcggacctatctcgac
ggcgcgctggaggtggtgaaggcgtggcgcgagtccgacgtggactcacgcgacgccgag
tccgtgtcaccggagtccgacgaggtgctcgggtggctcgcgggggatgtcgcgtggcgg
ttggggagctccgcggaggcgctcgacgcggatgcgccgctcacccggtacgggttggac
tcgctgcgggggctggacgtgatgcacgccatccagcggcggtggggtgtgtcactgccg
cccacgttcctcctccaaggcccgagcctgcgcgaggtggcggcgaaggtggagcaggag
cgaggcgcggcggtgcagcccgtgtcgtcttcgactcctgcgctcggagatgtttcaccc
cacgtctcggatggacagcgggcgctgtggttcctccaacggctggcgccgggcggcacc
gcgtaccacatcgcgcgggcgatgcggctggcgcctgacgtggacctggaggtcctcgcg
cgggtgttcgccgaactcgccgcgcgccatccggccctggcctgtgcgtttcccgaggag
cgaggcgagcccgtgtggcggtccgccgccgcgccggtgatggagcgggagtccgcgagc
ggctggagcgacgcggccttgcgggagcggctggatgcggagtcccagcgccccttcgac
ctggagcatggccccttgatgcgggtgcgtgtcttcacgggcgtcgagaccgggccggtg
ttgttgctcgtgttccaccacctcatcaccgacttctggtcgctggaggtgttggccgag
gagctgggcgtcctctacacggcgggcgttcggggtgtccccgcggagctgcccccgccg
ccgccgatggcgggccccatcctccgagagcgggaggcgcggctcactggggcgagaggc
gaggcgctccagtcctggtggcgtgagcgcttgggcggtgagctgccggtgctggagctg
ccgacgtcgaagccgagaccccggctccagtccttccgaggcgcggcggtgtccttccag
gtggaggcggatacggcctcccggctgttgtcgctggcgggcacgcacggcgcgactccg
ttcatggtgttgctggcgggctacgtggccttcttgcggcgctacaccggacaggaagac
ctggtggtggggacgccgacaacgggccgagcgcatgcggacctgtcgagacaactgagt
tacttcgtcaatcccgtggcgcttcgtgcgcgggtgccgagagggcagtccttcacctcg
ctgttgaaggaggtgcgcggcctcgtcttggaggcgctggagcaccaggagttgcccttc
gcccggatggtcgagcggctccagccccgacgggatgcggcccgtgctcctgtcttccag
acgatgttcgtgctgcatgccgggcgcccgggacgcgaggcgctcgcgcccttcgccctg
ggcggcgcggggactcgagtccggctgggcgcgctggagctggagtccgtgccgctgcgc
aatcaggcctccgccttcgacctgacgttgacgatggccgagtcggagggaggcttcgcc
gcgagcctggagtactgcacggacctgttcgacgcggcgctcgccgagcgcatggtgcgc
cacttccgaacgctgctggacgccgcggcgcgcgagcccgaggtgcccgtgttggacctg
cccctgctcgagggtgaggagcagcgcgtgctgctcgcagcgggccggcgcgcgacggcc
tccgaggagccctccgcccgaagtctgcacggtgccttcgaggccgccgtggcgaggtca
ccggacgcggtggcgttggtctccgggacgtcccgctggacgtacggcgaggtcgatgcc
tgggcggagagactgggcgcgaggttgcggcagcgaggcgtgggccccgaggtccgcgtc
ggagtcctgctggagcgaggacaccctgggacggtcatcgcgttcctcgccgtgctgaag
gcgggcgggacggtggtgccttgtgagccctcgcatcctcccgagcggatcgcatggatg
ctgcgggacgcgggggcgcgtggcctgctcgtgcaggagcgcctctcgaggcgcctggac
ctctcgtcggatgtgttgcgcctcctctgggaggagctgggcgggcacgagccgcgagcg
gaggacgtccgcaccgacgcgccctcgttcccgtctccggagtgctccgcgtatgtcatc
tacacctcgggaagcacggggcgcccgaagggcgtcgtggtgacccatcgcggagccctg
cacctggcggagtcgatggggcggggcttcgggttgggggcgggagaccgggtgctccag
ttcgcatccccggccttcgatgcctcgatcgcggagtacctacaagcgctcctgacgggc
gcggcgctgcacctgcctccctcgggcgagttgctggcgggagaggcgctgcaccgcgtg
ctgaaggaggagcgcatcacgctggtgacgctgcctccgtccgcgtgcgcgctgttgccg
gaggctccgctcccggacctgcggaggctggtctccgcgggagagtcctgcccggaggac
ctggtgtcgcgcttcgcgcccgggcggaccttcgtgaacgcctatggccccacggaggcg
accgtgtgctcgacgtgggccatctgccagccgggagagggcactccggacatcggccga
ccgttgcccgcggtggatgcctacgtgctcgacgaggcgctgaaccccgtccctcggggc
gtggcgggagagctgtgcgtcggcggtccgatggtggcgcgaggctacctgggccgtccg
gacctcacggccgagcgcttcgttccggaccctcatggaggagcgccgggtgggcgcctg
taccgcacgggagacgtggcccggtggcgtcccgatggccggttggagctgctggggcgc
gtggatgcgcaggtgaagctgcgcggcttccgcatcgagccgggggaggtggaagcggtg
ctgcgcgagctcgcgcggatgcggcaggcgcacgtgcgtgtgtggcgtcctccctctgga
ggggaggcccggctcgtggcctacgtggtgccgccggaagaggggctgcctcctcccgga
gagctgaaggcgagcctgcgagcccgcctgcccgagtacctggtgcccgcggacttcgtc
gcgctggaagccctgccgttgctgtccagcggcaaggtggacgtgcgcgcgctgccgccg
ccgatgcgcatggcacccgcggaaggggcaccccgaacgcccttggaagaggcgttgtcg
cgagcctgggcggagacgctcggcttcccggcggtgggcgtccactcgcacttcttcgat
gacctgggcggcagctcgctggcggcggtgcgggcgtgcgcgcgaatccgcgagtcgctc
gggcgggacgtccccatcacccacttcttcgagcatcccacggtccatgcgctggcgcgg
aggctgtcctccgattcggagccgggcacgcaggccgtgaagcaccaggagcgagcggag
gcccgtcgtcaggtcctccagcgtcgcggcggaaggaacacctga

DBGET integrated database retrieval system