KEGG   Myxococcus stipitatus: MYSTI_07226Help
Entry
MYSTI_07226       CDS       T02436                                 

Definition
(GenBank) AMP-binding protein
Organism
msd  Myxococcus stipitatus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(9276626..9278380)
Genome map
AA seq 584 aa AA seqDB search
MRGPTLPSMKFPTVNVMLAEASRSEFGLIFVDAAEREEVLPFSEVYRRARRTAAGLVRLG
LREGERVALMLPTSPAFMDAFFGVLLAGAVPMPLYPPVRLGRLEEYHRATARMLQVTTAS
LVLTDARVRLLLGPSVEKSRPRLGCHTVEDVSRGDDLYDAKVAPESLALIQFSSGSTVDP
KPVALSQAAVMAQVTALEVAIPLEDGAPRVGVSWLPLYHDMGLIGCLMSVLHYPGNLVLI
PPEAFLARPSLWLRAVSRHRGYISPAPNFAYGLCLKRVKDAEMEGVDLSSWKHALNGAEP
VSAETLQRFVQRFERWGFSARALRPVYGMSEASLAVTFPPRGRGPRSLGVDSGVLAREGR
VESGSRAMVSVGSPVAGFEVEVRDEQGGLLPERRLGRVFTRGPSLMMGYYGDAVATRRAL
SLDGWLDTGDLGFVVDGELYLAGRAKDVVIIRGANHAPQSFEEPLQSVEGVRLGCAVALG
FTPEDSEDEALLILAERSGPEGGPEVEERVRAAVVAATGVRPHTVRMLEPGTLPRTSSGK
LRRGEALRRYLAGELLPPKKVGMVGMAVEMARSALAMARAEHET
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggtccgaccttgccgtcgatgaagttccccacggtgaacgtgatgctcgcggag
gccagccggtcggagttcgggctgattttcgtggacgcggccgagcgcgaggaggtgctg
cccttctcggaggtgtaccgacgcgcgcggcgcacggcggcgggcctggtgcggttgggg
ctgcgcgaaggggagcgggtggcgctgatgttgccgacctcgccggccttcatggacgcc
ttcttcggggtgctgctcgcgggcgcggtgccgatgccgctgtacccgccggtgcggctg
gggcggctggaggagtaccaccgggccacggcgcggatgctccaggtgacgacggcgagc
ctggtgctgacggacgcgcgcgtgcggctgctcctggggccgagcgtggagaagtcgcgc
ccccggctgggctgccacacggtggaggacgtgtcgcgcggggacgacctgtacgatgcg
aaggtggcgccggagtcgctggcgctcatccagttctcctcgggctccacggtggacccg
aagcccgtggcgctgtcgcaggcggcggtgatggcgcaggtgacggcgctcgaggtggcc
atcccgctggaagacggcgcgccgcgcgtgggcgtgagctggctgccgctgtaccacgac
atggggctcatcggctgtctcatgtccgtgctgcactacccgggcaacctggtgctgatt
ccgccggaggccttcctggcgcgtccgtcgctgtggctgcgcgcggtgtcccggcaccgg
ggctacatctctcccgcgccgaacttcgcctatggcttgtgcttgaagcgggtgaaggac
gcggagatggagggcgtggacctgtcgtcgtggaagcacgcgctcaacggcgcggagccc
gtgtccgcggagacgctgcagcgcttcgtccagcggttcgagcgctggggcttctccgcg
cgggcgctgcggcccgtgtatgggatgtcggaggcgtcgctggcggtgaccttcccgccg
agagggcgagggcctcgctcgctgggcgtggactccggggtgctcgcgcgcgagggccgc
gtggagagcggctcgcgggcgatggtgagcgtgggctcccccgtggcgggcttcgaggtg
gaggtccgcgacgagcaggggggcctgctgcccgagcggcggctggggcgggtcttcacg
cggggaccatcgttgatgatgggttactacggtgacgcggtggcgacgcggcgcgcgctg
tccctggatggctggctggacacgggggacctgggcttcgtcgtggacggggagctgtac
ctggcggggcgcgccaaggacgtggtcatcatccgcggggcgaaccacgcgccgcagtcg
ttcgaggagccgctccagtccgtggagggcgtgcgcctgggctgcgcggtcgcgctgggc
ttcacgcccgaggacagcgaggacgaggcgctgctcatcctggcggagcgctccgggccg
gagggcgggccggaggtggaggagcgcgtccgcgcggcggtggtggcggcgacgggcgtg
cggcctcacacggtgaggatgctggagcccgggacgctgcctcggacgtcgagcggcaag
ctgcgtcggggggaggccctgcgccgctacctcgcgggtgagctgctgccgccgaagaag
gtgggcatggtgggcatggcggtggagatggcgcgcagcgcgctggccatggcgcgggcg
gagcacgagacgtga

DBGET integrated database retrieval system