KEGG   Mycobacterium smegmatis INHR2: LI98_07300Help
Entry
LI98_07300        CDS       T03432                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
msh00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:msh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LI98_07300
Enzymes [BR:msh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     LI98_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIU19945
LinkDB All DBs
Position
1557739..1559181
Genome map
AA seq 480 aa AA seqDB search
MTVEGANFIDGQWIPAASGRTFARHNPADPDDLVGVFPASDGVDVRTAVDALDKAAPEWA
ATPPERRAAILEAAAVQLESRAAELIAELIREEGKTTAEATMEVSRTPANLRFYAGEALR
STGTTYPAPGEGLVYTLREPVGIVGAITPWNFPFNIPSRKLGPALAAGNPVLYKPSELTP
LMGQRLVEALLDGGLPPSAVALVQGDGVAGAAVAADPRVAAVTFTGSTAVGRAIHQQVGP
QRRVQLEMGGKNPVVVAGDADLDAAAALIVKGAFGLSGQACTGTSRVIAVDEVHDALLDR
VVAKADALQVGPGNEPGVQMGPLASAAQREKFLHYVHAGITEGATLRCGGTTVGDHGFFV
RPAVFADALPTMRIVTEEVFGPLVAFQRAASLDEAVALANATEYGLAASIVTSDLAAATR
FARQSKTGLVKINQPTTGMAMNAPFGGYKASSTQTFKEQAGPTLMEFYTLEKTVYLTPAL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcgagggagccaacttcatcgacgggcagtggatcccggccgcgtcgggacgc
accttcgcgcgccacaacccggctgaccccgacgatctcgtcggggtcttcccggcctcc
gacggcgtcgacgtgcgcaccgccgtcgacgcgctcgacaaggccgcccccgaatgggcc
gccacgccgcccgaacgtcgtgcggcgatcctggaagctgctgccgtgcaactggaatca
cgcgcagcggagttgatcgccgaattgatccgcgaagagggcaagaccaccgccgaggcc
accatggaggtgagccggaccccggcgaacctgcgcttctacgccggcgaggcgctgcgg
tccacgggcaccacctaccccgcaccgggggagggtctggtctacacgctgcgtgagccc
gtcggcatcgtcggcgccatcacaccgtggaacttcccgttcaacatcccgtcacgcaaa
ctcgggccggcgctcgcggcaggaaatccggtgctgtacaagccctccgaactcaccccg
ctgatggggcagcgtctggtcgaggcgctcttggacggtgggctgccgccctcggcggtc
gcgctggtccagggcgacggcgtggcgggtgccgcggtcgccgcggatccacgcgtcgcg
gcggtcaccttcaccgggtcgacagccgtcggccgtgcgatccaccagcaggtcgggccc
cagcgccgcgtccaactggagatgggcggcaagaaccccgtggtggtcgccggggacgcc
gacctcgacgccgcggccgcgctcatcgtcaaaggcgcgttcgggctcagcgggcaggcc
tgcaccgggaccagccgcgtgatcgcggtcgacgaggttcacgatgcgctgctcgaccgc
gtggtggccaaggccgacgcgctgcaggtcgggcccggcaatgagcccggtgtgcagatg
ggtccgctggccagcgcggcccagagggaaaagttcctgcactacgtgcacgccgggatc
accgagggcgccaccctgcgctgcggcggcaccacggtgggcgatcacggattcttcgtc
cgcccggcggttttcgccgacgcgctgccgaccatgcgcatcgtcaccgaggaggtgttc
gggccgctggtcgcgttccagcgcgcggcatccctcgacgaggccgtcgcgctggccaac
gccaccgagtacggactggcggcctcgatcgtcacgtcggacctcgccgcggcgacacgg
ttcgcccggcagtcgaagaccggcctggtcaagatcaaccagccgaccacgggcatggcg
atgaacgcgcccttcggcggctacaaggcgtcgagcacccagaccttcaaggaacaggcc
gggccgacgctcatggagttctacacgctcgagaagaccgtctacctcaccccggccctc
tga

DBGET integrated database retrieval system