KEGG   Methanosarcina siciliae C2J: MSSAC_3122Help
Entry
MSSAC_3122        CDS       T03863                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
msj  Methanosarcina siciliae C2J
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:msj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSSAC_3122
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSSAC_3122
   00680 Methane metabolism
    MSSAC_3122
Enzymes [BR:msj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSSAC_3122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3865612..3867192)
Genome map
AA seq 526 aa AA seqDB search
MSRKSTYPKVMCTQHPDSASRYISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQ
IVSRLIEETDLVPGKDVFITPRAPSAVQENRFRQLMVMMSIAEANHGALEYSDVQAINEF
VHPMTGTVREILDAQQHMVDVSELAKKEFGFAMEVPRIIPLIEDAPALLHAKELAENTLL
AWKERFGTSPEKFRVFLGKSDSALSFGHVASTLSCKYAINGIFELNSELETETGIIFGAG
TLPFRGHLDLKNAENFFREYRGVGTITLQSALRYSHEKGDAESLVNLAKEKLPETPEIFS
AEEKEELVNLIGIFGTGYSRIIRELSSTINRLSDLLPQQRDRLMHRGSGGYSRSAPDISG
IVNLCRSDIGKELQASMPAENLHLPRAIKFTGALYSIGLPPEFIGTGTALKEAREKLGDE
ACERLLTKYFPSLVSDLSFASGYMDLNVASRFLSGACFKEVSKDIEVLHETLGLETHPEP
SYRILLEMMQPELLQAGTSGNCMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaatcaacttatccgaaagttatgtgcactcagcacccggactctgcttca
aggtatatctccacacaggaagagccgggggaagccattgaagctgcggtggtattcggc
tgtgacgaatatatgccggactatgagggaaaggcaactccctatcatcagaatgtccag
atcgtatccagattaatagaagaaacagaccttgtgcccggaaaagatgtttttatcact
ccccgggctccgagtgcagtccaggaaaacaggttcaggcagcttatggttatgatgtcc
attgccgaagccaaccatggggctcttgaatactcggacgtccaggcaatcaatgagttc
gtgcatcccatgacaggaacggtcagggaaatccttgatgctcagcagcatatggtagac
gtaagcgagcttgcaaaaaaagaattcggatttgcaatggaggtcccgcgtataatccct
cttatcgaagatgctcccgccctcctgcacgcaaaagaacttgccgaaaacacgcttctt
gcctggaaagagcgcttcgggacatcccccgaaaaattcagggttttcctgggcaaatcc
gactctgccctctctttcgggcatgtggcaagcaccctttcctgcaaatacgccataaac
ggaattttcgaactgaactccgaactcgaaaccgaaacaggcatcatcttcggagccgga
accctgcctttcagaggacaccttgacctgaaaaatgcggaaaacttcttcagggaatat
aggggtgtagggacaatcaccctgcagtctgctctcaggtacagccacgaaaaaggagat
gccgaatccctggtaaacctcgcaaaggaaaagctgcccgaaacccccgagatcttttcc
gcggaagaaaaagaagaactcgtaaaccttatcgggattttcgggacagggtacagccgc
atcatccgggaactgtcctctaccataaaccggctttccgacctcctcccccagcagcgg
gaccgcctgatgcatcgaggaagcggcggttattcacggagcgcccccgatatttcaggt
atagtaaacctctgccgcagcgacatcggaaaagagctgcaggcaagcatgcccgccgaa
aaccttcacctcccgcgggctatcaaatttaccggagccctctactccataggcctgcct
cccgaattcataggtaccgggactgcgcttaaagaagcccgggaaaaacttggagatgaa
gcctgtgaaaggctgcttacgaagtatttcccttcccttgtcagtgacctgagtttcgct
tccggatacatggacctcaacgtagcttcccgcttcctttccggagcctgcttcaaggaa
gtcagtaaagatattgaggtcttgcatgagaccctcggccttgaaacccaccctgaacct
tcataccgcatcctgcttgagatgatgcagcccgaactcctgcaggctgggacctcaggg
aactgtatggacgaggaggtttcacagctcgtatgctcgacccttaccaaaatgggaaaa
ataagaaaggctctgggttga

DBGET integrated database retrieval system