KEGG   Mycobacterium smegmatis INHR1: LI99_07860Help
Entry
LI99_07860        CDS       T03409                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
msn  Mycobacterium smegmatis INHR1
Pathway
msn00250  Alanine, aspartate and glutamate metabolism
msn00410  beta-Alanine metabolism
msn00430  Taurine and hypotaurine metabolism
msn00650  Butanoate metabolism
msn01100  Metabolic pathways
msn01110  Biosynthesis of secondary metabolites
msn01120  Microbial metabolism in diverse environments
msn02024  Quorum sensing
Module
msn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LI99_07860
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI99_07860
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI99_07860
   00430 Taurine and hypotaurine metabolism
    LI99_07860
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LI99_07860
Enzymes [BR:msn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LI99_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIU13430
UniProt: A0A0D6HD41
LinkDB All DBs
Position
1664312..1665691
Genome map
AA seq 459 aa AA seqDB search
MSHKQSRGPHVAPAYTGRLAMAPVPSLRLPDEAMDPSAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEDLRDDDPASAVG
VSTIGSSEAVMLAGLAMKWRWRAKAGDWKGRTPNLVMGANVQVVWEKFCRYFDVEPRYLP
MAEGRYVITPEQVLDAVDEDTIGVVAILGTTYTGELEPVAEICEALDKLAAGGGVDVPVH
VDAASGGFVVPFIHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRNKEHLPEELVF
RVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMQCLSQTARWLGDELRDSE
HFELISDGSAIPVVAFRLKGDPGYTEFDISQALRAHGWQVPAYTMPEGAEDVVVLRVVVR
EGFSADLARALKDDIITVLGQLDALKPRGQFDQLQPFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaagcagagtcgcggtccgcacgtcgcgccggcgtacaccggacggttggcc
atggcgcccgtgccgtcgctgcgcctgcccgacgaggccatggatccgtctgcggcgtac
cggttcatccacgacgagttgatgctcgacggcagctcgcggctgaacctcgcgacgttc
gtgacgacgtggatggaccccgaggccgagaagctcatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggccaccgcggccatcgaggcccgctgcgtgtcgatg
gtggccgacctgttccacgccgaggatctgcgcgacgacgacccggcgagcgccgtcggg
gtgtcgacgatcgggtccagcgaggccgtgatgctggccgggctggcgatgaaatggcgc
tggcgcgccaaggccggcgactggaaggggcgcacgccgaacctggtgatgggcgccaac
gtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgctacctgccg
atggcagagggccgctacgtcatcacgcccgagcaggttctcgacgccgtcgacgaggac
accatcggcgtcgtggcgatcctgggcaccacctacaccggcgagctggaaccggtcgcc
gagatctgcgaggcgctggacaagctcgccgcgggcggcggggtggacgtgccggtgcac
gtcgacgcggccagcggcgggttcgtggtgccgttcatccatcccgacctggtgtgggac
ttccggctgccccgcgtggtgtcgatcaacgtcagcggccacaagtacggcctgacgtac
ccgggtgtcgggttcgtggtgtggcgcaacaaagagcacctgcccgaggagctggtgttc
cgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttctcgcggcccggc
aaccaggtggtggggcagtactacaacttcctgcggctggggcgcgccgggtacacccag
gtgatgcagtgcctgtcgcagaccgcccggtggctgggcgacgagctgcgcgacagcgag
cacttcgagctgatctccgacggttcggccatcccggtcgtggcgttccgtctcaagggc
gatcccggatacaccgagttcgacatctcgcaggcactgcgggcgcacggctggcaggtg
cccgcgtacaccatgcccgagggcgccgaagacgtcgtggtgctgcgtgtggtggtccgt
gaggggttctccgccgacctcgcgcgggcgctcaaggacgacatcatcacggtgctgggc
cagctcgacgcgctcaaaccgcgcgggcagttcgaccagctccagcctttcgcgcattag

DBGET integrated database retrieval system