KEGG   Mycobacterium smegmatis INHR1: LI99_11910Help
Entry
LI99_11910        CDS       T03409                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
msn  Mycobacterium smegmatis INHR1
Pathway
msn00473  D-Alanine metabolism
msn00550  Peptidoglycan biosynthesis
msn01100  Metabolic pathways
msn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:msn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LI99_11910
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LI99_11910
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LI99_11910
Enzymes [BR:msn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LI99_11910
Peptidoglycan biosynthesis and degradation proteins [BR:msn01011]
 Precursor biosynthesis
  Amino acid ligase
   LI99_11910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIU14203
UniProt: Q9ZGN0
LinkDB All DBs
Position
2478431..2479552
Genome map
AA seq 373 aa AA seqDB search
MTAPNHPPGRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERFEVVAIGITPDGSWVLTD
GRPETLAITDGKLPAVTEASGTELALPAAPNRSGQLLALGNGPGEILAAVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGSGVLASAAGMDKEYTKKLLAAEGLPIGDQVVLRPGVETLD
LEQRERLGLPVFVKPARGGSSIGVSRVTAWDELPAAVALARRHDPKVIVEAAVIGRELEC
GVLEFPDGRLEASTVGEIRVAGVRGREDGFYDFATKYLEDAAELDVPAKVDDDVADEIRQ
LAVRAFTAIGCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAAGGIDYPTLLAA
MVDTAIARGTGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccccgaaccatcctcctggccgcacccgcgtcgccgtcgtctacggcgggcgt
agctcggagcacgcgatctcgtgcgtgtcggcgggcagcatcctgcgcaacctcgatccg
gagcgtttcgaggtcgtcgccatcggcatcacgcctgacggctcgtgggtgctcaccgac
ggtcggcccgagacgctcgcgatcaccgacggcaaactgcccgcggtgaccgaggcgtcg
ggcaccgaactcgcgctgcccgccgcgcccaaccgcagcggccagttgctggcgctgggc
aacggccccggcgagatcctcgccgcggtcgatgtggtgttccccgtgctgcacggtccg
tacggcgaagacggcaccatccagggcctgctcgaactcgcaggcgtgccctacgtggga
tcgggcgtgctggccagcgccgccggtatggacaaggagtacaccaagaagctgctcgcc
gccgaggggctgccgatcggcgatcaggtggtcctgcgtcccggcgtcgagaccctcgac
ctcgaacagcgtgagcggctcggcctgccggtcttcgtcaaacccgcgcgcggcggatcc
tcgatcggcgtcagccgggtcaccgcgtgggacgaactgcccgcagcggtcgcgctggcg
cgccgccatgacccgaaggtcatcgtcgaggccgcggtgataggccgtgaattggagtgc
ggtgtcctggagttccccgatggccgtctcgaggccagcacggtcggcgagatccgcgtg
gccggtgtgcgcggccgcgaggacgggttctacgacttcgccaccaaatacctcgaggac
gcggccgaactcgacgtgcccgccaaggtcgacgacgacgtcgccgacgagatccggcag
ctcgcggtgcgcgcgttcaccgcgatcggctgccagggcctcgcacgcgtcgacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacaccatgccggggttcaccaccatc
tcgatgtacccgcggatgtgggccgccggcggtatcgactatccgacgctgctggccgcg
atggtcgacaccgcgatcgcgcggggcaccggcctgcgctga

DBGET integrated database retrieval system