KEGG   Mycobacterium smegmatis INHR1: LI99_12380Help
Entry
LI99_12380        CDS       T03409                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
msn  Mycobacterium smegmatis INHR1
Pathway
msn00250  Alanine, aspartate and glutamate metabolism
msn00410  beta-Alanine metabolism
msn00640  Propanoate metabolism
msn00650  Butanoate metabolism
msn01100  Metabolic pathways
msn01120  Microbial metabolism in diverse environments
Module
msn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LI99_12380
   00650 Butanoate metabolism
    LI99_12380
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI99_12380
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI99_12380
Enzymes [BR:msn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LI99_12380
Amino acid related enzymes [BR:msn01007]
 Aminotransferase (transaminase)
  Class III
   LI99_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIU14293
UniProt: A0A0D6HVT2
LinkDB All DBs
Position
complement(2570279..2571532)
Genome map
AA seq 417 aa AA seqDB search
MTELSQALKQATGVIAARGEGVLLYDEQDRRYLDFTAGIGVTSTGHCHPRVVEAAQRQVG
TLIHGQYTTVMHRPLLTLVERLGEVLPAGLDRMFFANSGSEAIEAALRLSRQATGRPNVI
VFHGGFHGRTVAAASMTTSGTKFRSGFSPLMAGVHVSPFPDPTHFGWPVEQTTDFALSQL
DYVLQTVSAPADTAAFFVEPVLGEGGYVPANERFLAGLRERADAHGILLVLDEVQTGYGR
TGKFWGGEHFDAKPDILVTAKGLASGFPLSGIAASSELMAKAWPGSQGGTYGANAVACAA
AIATLDVIADENLVANAAERGAQLKQALQTVADKHEQITDVRGLGLMIGNEFRDADGKPD
GTTAAAVQQEAARRGLLLLTCGAWGQVVRFIPALVVSADEVEEAAGIWADAVSAVVS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactttcgcaggccctcaagcaggcaaccggcgtgatcgccgcccgcggcgag
ggcgtcctgctctacgacgaacaggaccgccgatacctcgatttcaccgcgggtatcggt
gtgacgagcaccggacactgccatccccgggtcgtcgaggccgcgcagcgacaggtgggg
acgctcatccacgggcagtacaccacggtcatgcaccggccactgctcaccctggtggag
cggctcggtgaggtgctcccggccgggctggaccggatgttcttcgccaactccggcagc
gaggccatcgaggccgcgctgcggctcagcaggcaggccaccggccgtcccaacgtcatc
gtcttccacggcggctttcacggcaggaccgtggccgcggcgtcgatgaccacctccggc
accaaattccggtcggggttcagcccactgatggccggcgtgcacgtatcgccgttcccc
gatcccacccacttcggttggcccgtcgaacagaccaccgatttcgcactctcgcaactc
gattacgtgctgcagacggtgagcgcgccggccgacaccgccgcgttcttcgtcgaaccc
gtgctgggcgagggcggttatgttccggccaacgagcgtttcctcgccggactgcgggaa
cgcgccgatgcgcacggcatcctgttggtgctcgacgaggtgcagaccggatacggccgc
acgggaaagttctggggcggcgagcatttcgacgccaaaccggacatcctggtgacggcc
aaaggcctggcgtcgggcttcccgctgtccgggatcgccgcgtcgtcggagttgatggcc
aaggcgtggccggggtcgcagggcggcacctacggggccaacgcggtggcctgcgcggcc
gcgatcgcgaccctcgacgtgatcgcggacgagaacctcgtcgccaatgccgcggagcgc
ggcgcacagctcaagcaggctctgcagacggtcgccgacaagcacgagcagatcaccgac
gtccgcggactcgggttgatgatcggcaacgaattccgcgacgccgacggcaaacccgac
ggcaccaccgcggccgcggtgcagcaggaggcggcccgccgcgggttgctgctgctgacg
tgcggcgcgtggggtcaggtggtgcgcttcatccccgcgctcgtcgtctccgccgatgag
gtggaagaggccgcgggcatctgggccgacgccgtgagcgccgtcgtgtcctga

DBGET integrated database retrieval system