KEGG   Mycobacterium gilvum Spyr1: Mspyr1_27250Help
Entry
Mspyr1_27250      CDS       T01376                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
msp  Mycobacterium gilvum Spyr1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2815899..2817632)
Genome map
AA seq 577 aa AA seqDB search
MTALTEASIPAVLADRAEKQPDDIAYTFVDYEADPAGVTDSLTWSEVHERVQIVAGKLAT
IGSPGDRAVILAPQSLEYIIGFLGAVAAGFIAVPLSMPQTRHHDERVTGAMADSTPVVVL
TTSAVVEDVRRYGQADPKQRLPKFLEIDTLDFDSPPKPAPAASLPKTAYLQYTSGSTRSP
AGVVVTHKNVVVNLEQLLTDYYEAYPDGPPADTTIVSWLPFYHDMGLIVGVFIPMMLGRP
AVLMSPVAFMMKPSRWMQLLGSNPSAFTAAPNFAFELAVKRTSDEDMAGKDLSTVVVMIN
GAERVHGSTVRRFNERFAAFGLPDSAMRPSYGLAEATVYVAASAGGRPPTAVRFDVEKLA
AGHAEASDGDDGTELISCGAPRSTTARVVDPDTLVENPAGKIGEVWLHGEHVAAGYWHNP
KLSELFAAQLSEPSAGTPKGPWLRTGDLGVMFDDELYIIGRIKDLLIVDGRNHYPDDIEA
TVAEFTGGRVAAVSVPDEASERLVVIAELKKQLDQSVLDSVRQQVTAAVSQTHSVRVSDF
VLVGPGSLPLTTSGKVRRASSVQLYLNDSFSRLDATT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgctgaccgaagcctccatccccgcggtactggccgatcgcgcggagaagcag
cccgacgacatcgcgtacacgttcgtcgactacgaggccgacccggccggcgtcaccgac
agtctgacgtggtcggaggtgcacgagcgcgtgcagatcgtcgccgggaaactcgcgacg
atcggctcgccgggcgaccgcgcggtgatcctggccccgcagagcctggagtacatcatc
gggttcctcggcgcggtggccgccggcttcatcgccgtcccgctgtccatgccgcagacc
cgccaccacgacgagcgcgtcaccggcgcgatggcggactcgacaccggtcgtcgtgctc
acgacctccgcggtcgtcgaggacgtccgcaggtacggccaggccgacccgaagcagcgg
ctgccgaaattcctcgagatcgacaccctcgacttcgattcgccgccgaagccggcgccc
gcggcgtcgctgcccaagaccgcctacctgcagtacacctcaggttcgacgcgcagcccc
gccggcgtggtcgtgacccacaagaacgtggtcgtcaatctcgagcagctgctgaccgac
tactacgaggcctatcccgacggcccgcccgcggacaccacgatcgtgtcgtggctgccc
ttctaccacgacatgggcctcatcgtcggggtgttcatcccgatgatgctgggccggccc
gcggtgctgatgagcccggtcgcgttcatgatgaagccgtcgcgctggatgcagctgctc
ggctcgaatccgagcgcgttcaccgcggccccgaacttcgcgttcgaactcgccgtcaag
cgcacctccgacgaggacatggccggcaaggacctcagcacggtcgtcgtgatgatcaac
ggggccgagcgggtgcacggctcgacggtgcgccggttcaatgagcggttcgccgcgttc
ggccttccggactccgcgatgcggccgtcctacggcctggccgaggcgacggtgtacgtc
gcggcgtcggcgggcggccgcccgccgaccgcggtgcggttcgacgtcgagaagctcgcc
gccgggcacgcggaagcatccgacggtgacgacggcaccgagttgatcagctgcggcgca
ccgcgctcgacgaccgcgcgggtggtcgatcccgacacgctcgtcgagaatcccgcgggc
aagatcggcgaggtgtggctgcacggcgagcacgtcgccgcgggctactggcacaacccg
aagctgtcggaactgttcgccgcgcagttgagcgagccgagcgccgggacgccgaagggt
ccgtggttgcgcaccggcgacctcggcgtgatgttcgacgacgagctctacatcatcggt
cgcatcaaggatctgctgatcgtcgacggccgtaaccactacccggacgacatcgaggcg
acggtcgccgagttcaccggcggccgcgtcgcggcggtctctgtccccgacgaggccagt
gagcgtctggtcgtgatcgccgagctcaagaagcagctcgatcaatcggtgctggactcg
gtccgccagcaggtcaccgcggcggtgtcgcagacccacagcgtccgggtgtcggacttc
gtgctggtcggacccggctcgctgccgctgaccaccagcggcaaggtgcgccgggcgtcc
agcgtccagctgtacctcaacgactcgttcagccgtctggacgccactacatga

DBGET integrated database retrieval system