KEGG   Mannheimia succiniciproducens: MS0165Help
Entry
MS0165            CDS       T00201                                 

Gene name
tufB
Definition
(GenBank) TufB protein
  KO
K02358  
elongation factor Tu
Organism
msu  Mannheimia succiniciproducens
Brite
Translation factors [BR:msu03012]
 Eukaryotic Type
  Elongation factors
   MS0165 (tufB)
 Prokaryotic Type
   MS0165 (tufB)
Mitochondrial biogenesis [BR:msu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MS0165 (tufB)
Exosome [BR:msu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MS0165 (tufB)
  Exosomal proteins of breast cancer cells
   MS0165 (tufB)
  Exosomal proteins of colorectal cancer cells
   MS0165 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
141198..142382
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIIRGSALKALE
GEAQWEEKILELANALDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKETAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccatggtaaaacaactttaacagcggcaatcactaccgtgttatcaaaacactac
ggtggtgcggctcgcgcattcgaccaaatcgataacgcgccggaagaaaaagcgcgcggt
atcaccatcaacacttcacatgttgaatacgatacgccgacccgtcactacgcacacgta
gactgcccgggacacgcggactatgttaaaaacatgatcaccggtgcggcacaaatggac
ggcgcaatcttagtagtagcggcgacagacggcccaatgccgcaaactcgtgagcacatc
ttattaggtcgccaagtaggcgtaccatacatcatcgtattcttaaacaaatgcgatatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgcgaacttctttctcaa
tacgatttcccgggtgacgatacaccaatcatccgtggttcagcgttaaaagcgttagaa
ggcgaagcgcaatgggaagaaaaaatccttgagttagcaaacgcattggatacatacatt
ccggaaccagaacgtgcgattgaccaaccgttcttattaccgattgaagacgtattctca
atctcaggtcgtggtacggtagtaacgggtcgtgtagagcgcggtatcatccgtacgggt
gatgaagttgaaatcgttggtatcaaagaaacggcgaaaacaacggtaacaggtgttgaa
atgttccgtaaattactcgacgaaggtcgtgcgggtgaaaacatcggtgcattattacgc
ggtactaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccgggttcaatcaca
ccacacacagacttcgaatcagaagtttacgtattatcaaaagaagaaggcggtcgtcat
actccgttcttcaaaggctaccgtccacaattctacttccgtacaacggacgtaacaggt
acaatcgaattacctgaaggcgtggaaatggtaatgcctggcgataacatcaaaatgaca
gtaagcttaatccacccgattgcgatggaccaaggtttacgtttcgcaatccgtgaaggc
ggccgtacagtaggtgcgggtgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system