KEGG   Meiothermus silvanus: Mesil_2400Help
Entry
Mesil_2400        CDS       T01246                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
msv  Meiothermus silvanus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesil_2400
   00650 Butanoate metabolism
    Mesil_2400
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mesil_2400
   00280 Valine, leucine and isoleucine degradation
    Mesil_2400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesil_2400
Enzymes [BR:msv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mesil_2400
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mesil_2400
Amino acid related enzymes [BR:msv01007]
 Aminotransferase (transaminase)
  Class III
   Mesil_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2434083..2435375
Genome map
AA seq 430 aa AA seqDB search
MPATESRNQALLELRQKVVPHGVSQVHPVVADKALGGKIWDVDGREYLDWVGGIGVLNVG
HNHPKVVRAVREQLERFCHTCFQVTAYEPYIRLAEKLCQSAPGDFEKKAFFVTTGAEATE
NAIKIARASTGRSAVIAFRHSFHGRTLMGMTLTGKAQPYRQNFGPFAPEVYHAPYPYEYR
GVDTQAALEGLQELFDTEVSPERVAALIIEPQLGEGGFVPAPAEFLRSLRALTQKHGIVL
IDDEIQTGIGRTGKFWAIEHAGIEPDLICFAKSIGGGLPIAGVLGRAEIMDAPLPGGLGG
TFAGNPLACAAGLAVLEVFAEEGLLERGQRLGEILHEGFRKLQSRFPHIGDVRGLGPMVA
IEIVQDPSTKEPDPVLTHRVFEAARERGLLLMKAGMYSNVIRCLVPLVVSEAEVHKGLEI
LEQSFEAALG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaccgaatcacgcaatcaagccctgttggagttgcggcaaaaggttgtccca
cacggggtttcacaggttcatccggtcgtggcggataaagcgctgggcggaaagatctgg
gacgtggacgggcgggagtacctggactgggtcggcgggatcggggtgctcaacgtagga
cataaccatccaaaggtagtccgggcggtccgggagcagctcgagcgcttctgccacacc
tgcttccaggtcacagcctacgagccttacatccggttagcagaaaaactctgccaaagc
gccccgggcgacttcgagaagaaagcctttttcgtgactaccggagccgaggccaccgag
aacgccatcaagatcgctcgagcctctactgggcggagtgcggtaatcgccttccggcat
agctttcacgggcgtaccctgatgggcatgaccctcaccggcaaagcccagccctaccgc
cagaacttcggccccttcgcccccgaggtctaccacgcgccgtatccttacgaataccgg
ggggtagacacccaagcagcgctcgagggcctacaagaactcttcgacaccgaggtctcg
ccggagcgggtagcggccctcatcatcgagccgcagctgggcgaggggggcttcgtccct
gccccggcggagttcctgcgctcgctgcgagccctcacgcaaaagcacggcatcgtcttg
atcgacgacgagatccaaaccggcatcgggcgcaccggcaagttttgggccatcgagcac
gcgggcatcgaaccggacctgatctgcttcgccaagagcatcggcggcgggctacccatc
gcgggcgtgctgggccgcgcggagatcatggacgcccccctccccggcgggctaggggga
accttcgcgggaaaccccttagcctgcgcagcggggctggcggtgctcgaggtcttcgca
gaggaaggtttgctcgagcggggccaaaggctcggggagatcctccacgagggcttcagg
aagctgcagtcgcgctttccgcacatcggcgacgtacgcggcctggggccgatggtggcc
attgagatcgtccaggacccctccaccaaggaacccgaccccgtcctcacccaccgggtc
ttcgaggcagctcgcgagcgagggctactcctgatgaaggctgggatgtactccaacgtg
atccgctgtctggtcccgctggtggtgagcgaggccgaggtgcataaggggttggagatc
ctcgagcaaagcttcgaggccgcgcttgggtaa

DBGET integrated database retrieval system