KEGG   Mesoplasma syrphidae: CXP39_03285Help
Entry
CXP39_03285       CDS       T05255                                 

Definition
(GenBank) hypothetical protein
Organism
msyr  Mesoplasma syrphidae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(764258..765148)
Genome map
AA seq 296 aa AA seqDB search
MAAGNDKIIMKILRKKMYTKNFDKFMDELKTSIVDLEYYTDFDKVINNNKKVRNKLDILN
TILGTQDSKKRLYDLLENNPDLKAVLPIFIAKREKNILTEKKQYNFLNISDMDAQEFVND
TGLIKLIEQKLLTNFNDFQLGIEVGLDTNARKNRTGTQMVKKVIDYLNEENINYKIEVNS
KLLENLYNIPKSEIDLIFKEKDAKKVFDFAFERKGILYLGEINAYTAGGSKLNEVCKSYI
YLNQKINCSSKMRFIWFTDGIGWRTAKNQIREAYEEIENLFNLSDLENHLIEGLLK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaggaaatgataaaattataatgaaaatattgaggaaaaagatgtacacaaaa
aattttgataaatttatggatgaattaaaaactagtatagttgatttagagtattacact
gattttgataaggttattaataataataaaaaagttagaaacaaacttgatattttgaat
acaattttggggacacaagattccaaaaaaagattatatgatttgttggaaaataatccc
gatttgaaagctgttttgccaatcttcattgctaagagagaaaaaaacatattaacagaa
aagaaacagtataattttttgaatattagtgatatggatgctcaagagtttgtaaatgat
acagggcttatcaaacttattgagcaaaaattactaactaattttaatgattttcaattg
ggtattgaagttggtttagataccaatgcaaggaaaaatagaacaggtactcaaatggtc
aaaaaagttattgattatctcaatgaagaaaacataaattataaaattgaagtaaactcc
aaattgttggaaaatttatataatattcctaaatctgaaatagatttaattttcaaagaa
aaagatgcaaagaaggtttttgattttgcttttgaaagaaaaggtattttatatttgggt
gaaattaatgcctatactgctggcggaagtaaattgaatgaagtgtgcaagtcatatatt
tatttaaaccaaaaaattaattgttcttcaaaaatgagattcatttgatttacagatggc
attggatgaagaacagctaaaaatcaaattagagaggcatacgaagaaatagaaaattta
tttaacttgagtgatttagaaaatcatttaatagaaggacttttaaaataa

DBGET integrated database retrieval system