KEGG   Moorella thermoacetica: Moth_2067Help
Entry
Moth_2067         CDS       T00308                                 

Definition
(RefSeq) hypothetical protein
Organism
mta  Moorella thermoacetica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2159458..2160396)
Genome map
AA seq 312 aa AA seqDB search
MDREMTTGQQVNGEPYMLPRLPGQQLRLTNLDKVFWPEGLTKFDLVEYYVDMAPGILPYL
RERPLVLKRYPDGITGEAFYQKECPAYAPEWVATLPVYHTDSDKTINYVLCNNEATLAWL
ANQGCIEVHAWLSRAGRLEYPDIVVMDLDPADGTTLVDVLEIALLVNRALKELHLTGYPK
NSGARGLHIFIPLYPRWTFREVTAAMGYLAHLIVQVYPRKATTEHLIHRRRGKVYLDYLQ
NVQGRSMTFPYSLRPLPGAPVSAPLTWEEVAAKKIYPGDFNIIRRRLEEWGDLYRELLER
PNDLTPLLELAI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggaaatgacaacaggacagcaggttaacggggagccctatatgctgccccgg
ttgccgggacagcagctccggctgaccaacctggacaaggtcttctggccggaggggctg
accaagtttgatctcgtcgaatattatgtcgacatggcccccggcatcctaccttacctg
cgggaacgtcccctggtcctgaagcgctacccggacggcattacaggggaggccttttac
cagaaagagtgccctgcctatgccccagagtgggtggcgaccctgcctgtctatcacacc
gatagcgataaaaccatcaattacgttctctgcaataacgaagcaaccctggcctggctg
gccaaccaggggtgcatcgaggtccatgcctggctctcccgggccggtcgcctggaatac
ccggatatcgttgtcatggacctcgaccctgcggacggcactacccttgtcgatgtgctg
gaaatcgccctcttggtcaaccgggctttaaaggaactccacctcaccggctaccccaaa
aattcaggcgccaggggcctgcatattttcatccccctttatccccgctggaccttccgg
gaagttacggctgccatgggatacctggcgcatctcattgtgcaggtttacccccgcaaa
gccaccaccgagcaccttatccacaggcgccggggcaaagtctacctggattacctgcaa
aatgtacaggggcggtccatgacctttccctacagcctacggcccctgcccggggccccg
gtttccgcccccttgacctgggaagaagtggcggcgaaaaagatttatcccggagatttc
aatatcatcaggcgccgcctggaagaatggggcgacttgtaccgggaactcctggagcgc
cccaatgatttaacacccctgttagagctggccatataa

DBGET integrated database retrieval system