KEGG   Methanothermobacter thermautotrophicus: MTH_1221Help
Entry
MTH_1221          CDS       T00009                                 

Definition
(GenBank) conserved protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mth  Methanothermobacter thermautotrophicus
Brite
Enzymes [BR:mth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MTH_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M T2SSE_N
Motif
Other DBs
NCBI-ProteinID: AAB85710
UniProt: O27289
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1122839..1123984)
Genome map
AA seq 381 aa AA seqDB search
MNSMNSDIPFDLIQERTGVPSSRLKVAFARGSLRLLESAGMQALLFKKPLGDLEAGTVIY
LGDETEVIRGFPKIRRTLLLSPTIQEHFRDRVAVEEKMNGYNVRIACLSSGETVALTRGG
HVCPFTTRKAQELLDLSEFFREHPDLVICGEMIGRDNPYVSQDYPEVGPLGFRVFDLREK
NTNRPLPVEERRALLDSYGLPNVRLFGVYPIEEAASEVADIIRALGMAGREGVVMKDPSM
EVPPLKYTSSQAHARELAYAFSYPFDFGRPFFFSRVIREGFQAYELDESDDETRERARRL
GEAIIYPMLERIKSISAGEAAYEDTVIDVEDREAAEEFIRHLVRLGVSATLADYRDGRAT
IRRFYQSTTDRINNYLKGGLY
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcaatgaacagtgacatccccttcgatctgatccaggaaaggacaggagtacca
tcctccaggttaaaggttgcatttgcccgggggagcctgaggctacttgaatctgcgggt
atgcaggccctcctcttcaagaagcccctgggggacctggaggcagggacggtgatctac
cttggagatgaaactgaggtcataaggggatttccaaagataaggaggacactgctactc
tcacccaccatccaggaacacttcagggacagggttgctgtagaggaaaagatgaacggc
tacaatgtccgtatagcatgcctatcatcgggagaaaccgttgcactcacaagggggggc
catgtctgcccattcaccacccgaaaggcccaggagctccttgacctttctgaattcttc
agggaacacccggaccttgttatatgtggagagatgattggaagggacaacccctatgtt
tcacaggactaccctgaggtcggacccctcggattcagggtattcgatctgagggagaag
aacacgaacagacccctccctgttgaagagaggagggcgctcctggattcctatggactt
cctaatgtgcgcctctttggggtctaccccattgaggaggccgccagtgaggtcgcggat
ataataagggccctgggaatggctggaagggagggtgtggttatgaaggaccccagcatg
gaggtgcctcccctcaagtacacctcatcacaggcccatgcacgtgaactcgcatacgcc
ttcagctaccccttcgacttcggaagacccttcttcttcagcagagtcataagggagggc
ttccaggcctatgaactcgatgaatcggatgatgaaacccgtgaaagggcacgccgcctc
ggggaggcaataatataccccatgcttgagaggataaagagcatatcagctggtgaggca
gcctatgaggacacggtcatcgacgttgaggaccgggaggcggcagaggaattcatacgt
caccttgtccgtctgggggtctcagccacccttgcagattaccgtgacggcagggcaacc
ataaggcgattctatcagtcaacaacagacaggataaacaactaccttaaggggggtctc
tactga

DBGET integrated database retrieval system