KEGG   Microbulbifer thermotolerans: A3224_05410Help
Entry
A3224_05410       CDS       T04393                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mthd  Microbulbifer thermotolerans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mthd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3224_05410
  Amino acid metabolism
   00310 Lysine degradation
    A3224_05410
   00380 Tryptophan metabolism
    A3224_05410
Enzymes [BR:mthd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A3224_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1289367..1292195
Genome map
AA seq 942 aa AA seqDB search
MHESTMEQLWRSSHISGGNAAYVEELYETYLHDPNGVPEEWRSYFDSLPRVNGVGDVSHA
AVRRHFELLAKHRTRPLAAPGAGAINIEHERKQVKVLQLISSYRHRGHKKATLDPLGLMA
REQVPDLQLNYHGLTEGDYDTTFQTGDLFFGKGEATLREIVEGLERTYCGNLGAEIMHLS
NLEEQQWFQQRLERSQSTPNFGADIRVEILQRLSAAEGLERHLDSKYPGTKRFGVEGGES
LIPMMDALIRRSGTYGVKEIVIGMAHRGRLNTLVNILGKNPADLFEEFEGKKTLDTSGDV
KYHQGFSSNVMTPGGEVHLALAFNPSHLEICAPVVEGSVRARQDRRGDQTGEKVLPINIH
GDAAFAGQGVVQETLQMSQTRGFYTGGTVHIVLNNQVGFTTSKREDARSTEYCTDVAKMI
DAPVLHVNGDDPEMVVLAALLAVDYRYEFKKDIVIDLVCYRRRGHNETDDPSGTQPLMYQ
AIRKHKTTRTLYAEKLVNEGVLDKAAADKLASDYRDKLDRGEDVATGLVKQPDSSMFVDW
TPYLNHDWLTPADTSFALPKLKDVASRMTTIPDGIVLQRQVSKIYEDRRKMAAGAMPLNW
GMAETLAYGTLLEQGYMVRLTGEDVGRGTFSHRHAVIHSQKDGQSYVPLQHMYDGQPPFY
IYDSLLSEEAVLAFEYGYATTTPKSLVIWEAQFGDFANGAQVVIDQFITSGEHKWGRMCG
LVMMLPHGYEGQGPEHSSARLERYMQLCAEHNIQVCNPTTPAQIFHLLRRQAIRPMRRPL
VIMSPKWILRHKLATSSLDELAEGRFQNVIQDEGVDPTKVKRLILCSGKVYYHLLEARME
REQDDVAFVRLEQLYPFPDEEFVAAVSAFKNIESVAWCQEEPMNQGAWYHSQHHLRRLLA
ETHPGLELQYVGREPSAAPAAGYMSTHLEEQNKFINEALTVK
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaaagtaccatggagcagctgtggcgtagctcccatatctccggaggcaatgcc
gcctatgtggaggaactgtacgagacctatctgcacgaccccaacggcgtgccggaggaa
tggcgcagttacttcgacagcctcccccgggtaaacggtgtcggcgacgtctctcacgct
gcggtgcgccgccattttgaactgctcgccaaacaccgcacccgcccgctggccgctccc
ggtgccggcgccatcaacatcgaacacgaacgcaagcaggtcaaggtcctgcagttgatc
agctcttaccgtcaccgcggtcataaaaaagctaccctggaccccctgggactgatggcg
cgcgagcaggtaccggatctgcagcttaattatcacggcctcactgaaggggattacgac
accaccttccagaccggggatctctttttcggcaagggagaggccacgctgcgggagatt
gttgaaggcctggaacgcacctactgcggcaatctgggtgcggaaattatgcacctgtcc
aatctggaagagcagcagtggttccagcagcgccttgagcgcagtcagtccacacccaac
ttcggcgccgatatccgggttgagatactgcagcgcctgtccgcggcagaggggctggaa
cgccacctggattccaagtacccgggtaccaagcgctttggtgtcgaaggtggtgaaagc
ctgatcccgatgatggacgcactgatccgccgttcgggcacctacggtgttaaggaaatt
gtgatcggtatggcccaccgcggccgcttgaataccctggtcaatattctgggtaagaac
cccgcggatctgttcgaggagttcgagggcaagaagaccctggacacttccggtgatgtt
aagtaccaccagggcttttcttccaatgtcatgactccgggcggcgaggtacacctggct
ctggctttcaatccctcgcatctggaaatctgtgcgccggtggtagagggttcggtacgc
gcccgacaagaccgccgcggcgaccagaccggcgagaaagtactgccgatcaacatccac
ggcgatgccgccttcgctggccagggtgtggtgcaggaaactctgcagatgtcccagacc
cgtggcttctacaccggcggtaccgtgcacatcgtgctcaacaaccaggtgggcttcacc
accagcaagcgcgaagacgcccgctccaccgaatactgcaccgatgtggccaagatgatc
gacgccccggtgctgcacgtgaatggcgacgatccggaaatggtcgtgcttgccgctctg
ctggcggtggactaccgctatgaattcaagaaagacattgtcatcgacctggtgtgttac
cgccgccgcggtcacaacgagaccgatgatccgtcaggcactcagccgctgatgtaccag
gcgatccgcaagcacaagaccacccgtaccctgtacgcggagaaactggtcaacgaaggt
gtgctggataaagccgccgcggataagctggccagcgactaccgcgacaaactggatcgc
ggtgaggatgtggccacgggactggtgaaacagcccgacagctccatgtttgtggactgg
acgccctacctgaaccacgactggctgaccccggctgataccagctttgcactgccgaaa
cttaaggacgtggccagccgcatgaccacgattccggacggcatagtattgcagcggcaa
gtgtccaaaatttatgaggaccgccgcaagatggctgccggcgccatgccgctgaactgg
ggtatggccgaaaccctggcttacggcacgctgctggaacagggctatatggtgcgcctg
accggtgaggacgtgggccgcggcaccttctcgcaccgtcacgcggtgatacacagccag
aaagacggccagtcttacgttccgctgcagcacatgtacgatggccagccgcctttctat
atatacgactccctgttgtcggaagaggctgtgctggcatttgagtacggctacgcaacc
actacacccaagtctctggttatctgggaggcccagttcggcgactttgccaacggtgcc
caggtggtgattgaccagttcatcacttccggtgaacacaagtggggccgtatgtgtggg
ctggtaatgatgctgccgcacggttacgaagggcaggggccggagcactcctccgcgcgc
ctggagcggtatatgcaactgtgcgccgagcacaatatccaagtgtgcaaccccaccacg
ccggcacagattttccacttgttgcgccgccaggcgatacgcccgatgcgccgcccgttg
gtgatcatgagtcccaagtggattctgcgtcacaagctggccacttcgagcctggacgag
ctcgccgaaggcaggttccaaaatgtcatccaggacgagggcgtggatcccaccaaggtc
aagcgtctgatcttgtgctccggcaaggtttactaccacctgctggaagcccgcatggag
cgcgaacaggacgatgtggcttttgtgcgtctcgaacagctgtatcccttccccgatgaa
gagtttgttgcagcggtgtccgcgttcaagaacatcgaaagcgtggcctggtgtcaggaa
gagccgatgaaccagggagcttggtatcacagtcagcaccatctgcgccgtctgctggcg
gaaacgcatcccggactggaattgcagtatgtgggccgcgaaccctccgccgcaccggcg
gccggttatatgtccacgcatctggaagagcagaacaaatttattaacgaggcgctgacc
gttaaataa

DBGET integrated database retrieval system