KEGG   Methanosarcina thermophila CHTI-55: MSTHC_0081Help
Entry
MSTHC_0081        CDS       T03891                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mthe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSTHC_0081
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSTHC_0081
   00680 Methane metabolism
    MSTHC_0081
Enzymes [BR:mthe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSTHC_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(100694..102274)
Genome map
AA seq 526 aa AA seqDB search
MSSKTEFPKVMCTQHPDSASRYIATQEEPEEAIEAATVFGCDEYMPDYEGKATPYHQNVQ
IVSKLIEETNLVPGKDFFITPRAPSAVQENRFRQLMVMMSIAEANYNAHEYPDIQAINEF
VHPMTDSVREILEAQQHMVAVSELAKKEFGFSMKVPRIIPLIEDAPSLLYAAELVENTMH
AWKERFGASPDKFRVFLGKSDSALSFGHVASTLSCKYAINGLSELNSEIDTQIGIIFGAG
TLPFRGHLDLKNADNFFREYRGIGTITLQSALRYSHKKGDAEALVNLAKAKLPETPELFS
AEEKKEIVNLIGIFGAEYSRILRQIAPMINRIADLLPQQRDRLMHKGTGGYSRNAPDISG
VVKLCRTDVGKELEASMPAENLHLPRAIKFTGALYSIGLPPEFIGTGRALQKAQEKLGEA
ACENLLTKYFPSLASDLNFASRYLDLNVASRFLPEACLKEIRKDIEIVREIFDLETKPEP
SYRILLEMMQPDLLQAKSAEECMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaaaactgaatttccaaaggtaatgtgtacccagcaccctgattcggcatcg
agatatatcgcaacacaggaagaacctgaagaagctatagaagctgcaacggtcttcggt
tgtgatgaatacatgccggattacgaaggaaaggcgacgccttaccatcagaatgtccag
attgtatcaaaacttatagaggaaactaaccttgtgcccgggaaggactttttcatcacg
ccgagggctccgagtgcagttcaggaaaaccggttcaggcaactcatggttatgatgtcg
attgcagaagctaattacaatgcacatgagtatccggacatccaagcaatcaatgagttc
gtgcatcccatgacagacagcgtcagggaaattcttgaagcccagcaacatatggtagct
gtaagtgaacttgcaaaaaaggaattcgggttctcaatgaaagtcccgcgcataattcct
cttatcgaagatgctccttcactgctatatgcagcagagcttgtcgaaaacacgatgcat
gcctggaaagaacgttttggggcatcaccggacaagttcagggtatttctgggaaaatcg
gattctgccctatctttcgggcatgttgcaagcacattatcctgcaaatacgcaataaac
ggactatccgagctaaattccgaaatcgacacccaaatcgggattatcttcggagcaggg
actctgcctttcaggggacaccttgacctgaaaaacgcagacaatttcttcagggagtac
cgggggataggaaccattactctccaatcagccctcaggtatagccataaaaaaggcgac
gctgaagccctggtaaatcttgcaaaggcaaaactgccggagacacctgaacttttttca
gccgaggaaaaaaaagaaatagtaaatctcatagggatatttggagcagaatacagtcgg
attctcaggcagatagctcccatgataaatcggatagctgatcttctcccccagcagcga
gaccgtcttatgcataaaggaacaggcggctattcaagaaatgctcctgacatttcgggt
gttgtcaaactctgccgcaccgatgtaggaaaagagcttgaagccagcatgcctgccgaa
aacctccatcttcccagggcgatcaagttcacaggtgcactttattccataggcctgcct
ccagaattcataggcacagggcgcgcccttcaaaaagcgcaggaaaaactcggagaagcc
gcctgtgaaaatctactgacaaagtactttccttccctagcaagcgacctgaattttgca
tcccggtaccttgacctcaatgtagcttcgcgcttcctgcccgaagcatgtctgaaagaa
atccgcaaagacattgagatagtacgtgagatctttgaccttgaaaccaaacccgaaccc
tcataccgcatcctgctggaaatgatgcagcccgaccttctccaggcaaaaagtgcagaa
gaatgcatggatgaggaagtttcccagcttgtgtgctcgaccctgactaaaatggggaaa
atcaggaaggctctcggttaa

DBGET integrated database retrieval system