KEGG   Methanosarcina thermophila CHTI-55: MSTHC_1654Help
Entry
MSTHC_1654        CDS       T03891                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
mthe00630  Glyoxylate and dicarboxylate metabolism
mthe01100  Metabolic pathways
mthe01120  Microbial metabolism in diverse environments
mthe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mthe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSTHC_1654
Enzymes [BR:mthe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSTHC_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB15972
UniProt: A0A0E3NFY1
LinkDB All DBs
Position
complement(2065863..2067149)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDTGYIPKDTDLTCEFHIEPSAGVNFEEAATHMAGESSIDSWTEIVTLSPELATK
LKPHVFYVDEGSQTVRVAYSEELFELGSVPQVLSAVAGNILSMKVVDNLRLQDIAFPKSM
LREFKGPKFGLPGVRKLTGVEDRPLIGTIVKPKVGLNSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNSFEKRAELTLKLAEKAEAETGERKMYICNITAPTCKEMIRRMNVLKDLGAHY
AMIDIVPAGWTALQTLREEVEDTDLVLHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLNLRDECVLDNVPADESQHVLAQDWGGLRPMFPVASGGLAPT
MIPDLYSIFGRDIIMQFGGGIHAHPMGTAAGATACRQALEATLEGVSLQEYAKKHKELEA
ALDKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagagactatatagacacgggctatatcccgaaggataccgatctgacatgtgaa
ttccatatcgagccgtcggcaggagtgaactttgaggaagctgcaacccatatggcaggg
gaaagctctatagactcctggactgaaattgttacactcagtcccgaacttgcgaccaag
ttgaaaccccatgtattttatgtggacgagggatcacaaactgtaagggtagcttattcc
gaagaactctttgaactgggttcggtcccgcaggttctgagtgcagttgcaggaaacatc
ctgagtatgaaagtcgttgataatctgaggctgcaagatatcgcttttcctaagtcaatg
ctccgtgagttcaaaggacccaaattcgggttgccaggagtcaggaaacttacaggtgta
gaagacagacctctcataggaactatcgtcaagccgaaagtggggttaaactctgaaaaa
cacgccgaggtagcttacaactcttttgctggaggctgcgaccttgtcaaggatgatgag
aaccttacggatcagaagtttaacagctttgaaaaaagagccgaactcacccttaaactt
gcagaaaaggcagaagctgaaaccggagagcgcaaaatgtatatctgcaacattactgcc
ccgacctgcaaggaaatgatccgccgcatgaatgtccttaaagacctgggtgcgcactac
gcaatgatcgacattgttcccgcaggctggactgcgcttcagaccctaagagaagaagtt
gaagacacagatcttgtacttcacgcccaccgatgtatgcactcagcctatactcggaat
cctcgccacggaataagcatgcttgtcgttgccaagctctgcagattgattggacttgac
cagcttcacataggtacagttgttggaaagatgcacggagaaaagcacgaggttctgaac
ctccgggatgagtgcgtacttgacaatgtgcctgcggatgaaagccagcacgtccttgcc
caggattggggaggactgagaccaatgttcccggttgcatcaggagggcttgccccgact
atgattcctgacctgtactctattttcggaagggatattatcatgcagttcggcggcgga
attcatgcacatcctatgggtacggcagcaggagctactgcttgcagacaggcgctggag
gcaacccttgagggagttagcctgcaggaatatgcgaaaaaacacaaagaacttgaagct
gcccttgataagtggttgaagaaataa

DBGET integrated database retrieval system