KEGG   Methanosarcina thermophila CHTI-55: MSTHC_1989Help
Entry
MSTHC_1989        CDS       T03891                                 

Definition
(GenBank) Catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mthe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSTHC_1989
  Amino acid metabolism
   00380 Tryptophan metabolism
    MSTHC_1989
Enzymes [BR:mthe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MSTHC_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2449033..2451240
Genome map
AA seq 735 aa AA seqDB search
MRIQISVFEIWKPELIEKVAIVEKKRMVNENSKDEQLEMFREDPERDFLTTNQGVRVSNT
DISLKAGERGPTLLEDFHFREKLTHFDHERIPERVVHARGSGAHGYFQVYEPMTEYTSAK
FLQDPNKKTPVFVRFSTVVGSRGSADTVRDVRGFAIKFYTEDGNYDLVGNNIPIFFIQDA
IKFPDLVHAIKPEQDNEIPQASAAHDTFWDFVTCHPETAHMIMWVLSDRALPRSYRMMQG
FGVNTFRFVNSEGKGRFVKFHWRPLLGIHSLVWDETQKIAGKDPDFNRRDLWEAIEMGDY
PEYEFGVQILEEEDEFKFDFDILDPTKIWPEEDVPIKWIGKMTLNRNPDNFFAETEQVAF
CPANVVPGIDFSNDPLLQGRLFSYLDTQLIRLAGPNFHEIPINRPLAPIANNQREGYHRT
TINKGKASYFPNTVGENLPRPASVEEGGYAHYTEKIEGKKIRARSEKFKDFYSQAKLFWN
SMSEPEKKHIIEAFHFEVGKVNDKNIRKAVVDMFNNVDGDLAIEIAKGVGVPAPEKKGGS
PVMKESPNLSQERSEHTVKNTIKTRRIAIIAANGYNHNDVSQVMQALEAGGARAHIISKH
QGMLKSSSGESIEVDKSYVTTASVFYDAVYIPGGKENVETLKMQGDAIHFVNEAFRHCKP
LGATGEGIELLKAANLPDIQFAGKESADKEIPLISDKGVVTAVNGEDRSAFNESFTTAIA
KHRHWDREKKEQVPA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcaaatttcagtttttgagatctggaaaccagaactaatagagaaggtggca
atagtggagaaaaagagaatggtcaatgaaaatagcaaagatgagcagttagagatgttt
cgtgaagaccctgagcgcgatttcctgacaacaaatcagggcgtcagggtcagtaatact
gatatttcgctcaaggcaggggaaaggggtccaaccctgcttgaagatttccatttcagg
gagaaattaactcattttgaccatgagcgaattccggaaagggttgttcatgcccgtggt
tccggagcacacgggtatttccaggtctatgagcctatgacagagtatacgagtgcaaaa
ttcctgcaggatcccaataagaaaacgcccgtctttgtacgtttctcaactgttgtggga
tccagaggttcggctgataccgtgagagatgttcggggttttgcgataaagttctacact
gaggatggaaactatgatcttgtcggcaataacattcctatctttttcattcaggacgca
atcaaatttcctgaccttgtccacgcaattaaacccgagcaggacaatgagataccccag
gcttcagcagctcatgatacattctgggattttgtcacctgccacccagaaactgcacac
atgatcatgtgggttctttccgatcgtgcgcttcccaggagttaccgcatgatgcagggc
tttggggttaacaccttccgtttcgttaattcggagggtaagggaagatttgtaaagttt
cactggagacccctgcttggcattcactcgcttgtctgggatgaaactcagaagatagca
ggaaaagatcccgattttaaccgacgcgacctgtgggaagcaattgaaatgggagactat
ccggaatatgagtttggagtgcagatcctggaggaagaagatgagtttaaatttgacttc
gatatcctcgatcccactaaaatctggcccgaagaagatgtacccattaaatggataggg
aaaatgacccttaatcgcaaccctgacaacttctttgctgaaaccgaacaggttgcattc
tgcccggcaaatgtggttcccgggatcgacttctctaacgatccgcttcttcagggacgc
cttttctcatatctcgatactcagctaatccgcctagccggtccgaatttccatgaaatt
ccgattaaccgaccgctggcacctatagccaataatcagagggaaggttatcaccgcaca
acgataaacaaaggcaaagcaagttatttccctaacacagtaggagaaaacctcccgcgt
cctgcctctgtagaagaaggtggatacgcccactacacggaaaaaatagaaggaaaaaag
atccgcgcccgcagcgaaaaattcaaggatttttacagtcaggcaaaattattctggaac
agtatgtcggagccggaaaagaaacatatcatagaggcattccattttgaagttggaaaa
gtcaatgataaaaatatacggaaggcagttgttgatatgttcaacaatgtggacggagat
cttgcaattgaaattgcaaagggagtaggggttccggctcctgagaagaaaggtggatct
cctgtcatgaaagagtctccgaatctcagccaggagcgttcggagcatacagtgaagaat
acaattaaaaccagaagaattgctatcattgctgcgaatggatataaccataatgatgtc
agccaggtgatgcaggctttagaggctggcggagcaagagcccatattatctctaaacac
cagggaatgttaaagagttcaagcggagaaagtatcgaggttgataagagctatgtcacc
acagcctcagtattttatgatgctgtatacatcccgggaggaaaagagaatgtcgagacc
ctgaaaatgcaaggagatgcaatccatttcgtcaatgaggcgttcagacactgcaaacct
cttggagcaaccggtgaaggcattgagttacttaaagccgcaaacctccctgatatacaa
tttgcagggaaggaatcggctgataaggagattcctttgatttcagataaaggtgtcgtg
acggctgttaatggggaagacaggagtgcttttaatgagtccttcactactgcaattgca
aagcaccgtcactgggatagggagaagaaagaacaggttccggcttga

DBGET integrated database retrieval system