KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_23530Help
Entry
MRGA423_23530     CDS       T01994                                 

Definition
(GenBank) hypothetical protein
Organism
mti  Mycobacterium tuberculosis RGTB423
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4175595..4176698)
Genome map
AA seq 367 aa AA seqDB search
MASIGDTGGMTGNCMCSFLRAACWNSDMAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGT
KRRLVEYYFAVAGGPMLTALRDRPTHLQRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFP
SGRMADALKVTHPAAIVWAAQMGTITLHPWQVRCPDTEHPDELRIDLDPQPGTGFVEART
VAVDVLRSVLDDLGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIALAREVERRAPDA
VTTSWWKEERGARIFIDFNQNARDRTMASAYSVRPTPIATVSMPLTWEELAGADPDDYTM
TTVPELVKIRDDPWAGMDDVAQSIAPLLDLAARPTRSAGSVTCRIRRATIRRCRANPSGC
SRAGIPT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttggccagcatcggcgacaccggcggcatgacgggtaactgcatgtgctcattcttgcgt
gcggcatgctggaattccgatatggcggcggcagctgaggaactcgacgtcgacggcatc
gcggtgcggttgactagcccggacaggatgtatttcccgaagctggggtcgcacggcacc
aagcgccgcctcgttgagtactacttcgccgtggccgggggtccgatgctgacggcgctg
cgtgaccggccgacgcacttgcagcgcttcccggacggcgtcgacggcgagcagatctac
caaaagcggatcccgcggcaccgccctgactacctgcagacgtgccgggtgacgtttccg
tcggggcggatggctgacgcgctgaaggtgacccacccggcggcgatcgtatgggcggcg
cagatgggcacaatcaccctgcacccgtggcaagtgcgctgccccgacaccgagcacccc
gacgaattgcgcatcgatctagatccgcaaccgggcaccggcttcgtggaggcgcgtacg
gtcgccgtcgatgtgctccggtccgtgctggacgacctcggtctggtcggttatccgaag
acatccgggggtagagggattcacgtattcctgcgcatcgccaccgactgggacttcgtc
gaggtgcgtcgggcgggcattgcgttggcccgggaagtcgagcgccgcgcaccggatgcg
gtgacgacgtcgtggtggaaggaagaacggggcgcgcgtatcttcatcgacttcaaccaa
aacgcccgcgaccgcaccatggcgtcggcctattcggtgcgtcctaccccgatcgcgacg
gtatcgatgccgttgacctgggaagagctggccggcgcggatcccgacgactacaccatg
accacggtgcccgagctggtgaagatccgcgacgacccctgggccggcatggacgacgtg
gcccagtcgattgcaccattgctggacttggccgcccggccgacgaggagcgcgggctcg
gtgacatgccgtatccgccgagcaactatccgaagatgccgggcgaacccaagcgggtgc
agccgagccgggataccgacttga

DBGET integrated database retrieval system