KEGG   Thermothelomyces thermophila: MYCTH_40111Help
Entry
MYCTH_40111       CDS       T02231                                 

Definition
(RefSeq) glycoside hydrolase family 2 protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
mtm  Thermothelomyces thermophila
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCTH_40111
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYCTH_40111
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MYCTH_40111
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MYCTH_40111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(10294277..10296979)
Genome map
AA seq 900 aa AA seqDB search
MWFSNGLTNACGLAFLGALLLSVVDAKPMPKEGGRDRISINTGWRFYRSEYNTDKLAYDL
SRNDYANRTDLTVLKPWILPSANDFIADPAARHRRPSGEPTIGIPFVRSSYDDTEWETVD
LPHDWAIKGPFYVGDNVPVGGGMGRLPVHGIGWYRRKVEMTKADEGRSIYLDIDGAMSYS
IVWLNGHLVGGWPYGYSSYRLDLTPYLKLGDDNLLAIRVDNPGNSSRWYPGGGIYRNAWL
TKTSPTHVGQWGTFITSRSVSKSSAVLDLAVQVENAGETSQKLSVVTDVYILDSATGEAR
TKVASFPRQTITVAAGHKVSVNASTTVKKPALWGPPPSQSPNMHVAVTRLYNRNNDIVDT
YLTDFGIRSVVYDADHGLLVNGERIRIQGVNGHHDLGALGAAFNVRAAERQLEVLQELGC
NALRVSHNPPAPELLDLADRMGILIYDEAFDGWQLSKNPNDFHLIFDDWSEADLRAMVRR
DRNHPSVIIWSIGNEVGEQTTGDSGAAVARRLRQIVRSEDETRPVTASMNAARPNMPFPG
ELDLISLNYQGEGIRDTGPYAGLPGISTPPLYLPFHDAFPDKLIVSSETAATVSTRGTYF
FPITNWTSAPANYTVGSGGNDTLLQVSDYGLYTAPFGSSPDKVFVAQDNASFVSGEFVWS
GWDYIGEPTPYYAARSSYFGIIDLAGFKKDRFYQYQARWRPDHPVAHILPHWTWGADRVG
EVTPVHVFSNGDQAELWVNGKSQGRLRRESESVYRFRWDNVTYQPGEVRVVTYRNGKQWA
SDRVVTAGVPVALRLRADRSAIAGDGLDLSFLTATVVDSKGNVVPQADNEITFTVSGRGG
GEIVATDNGDPRDFTSFASRTRKAFSGLALGIVRANRKGDITVTASAPGLARAVVKLTAN
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgtggttttccaatggtctcaccaatgcctgtgggctcgccttcctaggcgcgctgctg
ctgtccgtagtagacgcgaagccaatgccaaaggaagggggacgcgacagaatcagcatc
aacaccggctggcgcttctaccggagcgagtacaacaccgacaagctggcctacgacctg
agccgcaacgactacgcgaaccgcacagatttgaccgtcttgaaaccgtggattctgccc
tcggctaatgacttcatcgcagacccggccgcacgacaccggcgcccttccggcgagcca
accatcggcatcccctttgtgcggtcgagctacgacgacaccgagtgggagaccgtcgac
ctgccacacgactgggccatcaagggtccattctacgtcggggacaatgttcccgtcggc
ggcggcatgggccgcttgcccgtccacggcatcggttggtaccgccgaaaggtggaaatg
accaaggccgacgagggcaggtccatctacctcgacatcgacggagccatgtcgtactcg
atcgtctggctcaacggccacctcgtcgggggatggccctacggatactcttcctaccgt
ctcgacctgacgccttacctcaagctcggcgacgacaatctgttggccatccgcgtcgac
aatccagggaactcatcgcgctggtaccccggcggaggcatttaccgcaatgcttggctc
accaagacaagcccgacacacgttgggcagtggggcacctttatcacatcgaggagcgtg
tccaaatcgtccgcggtcctcgacctcgccgtccaggtcgagaacgctggagagacctct
cagaagctgagcgtggtgacagatgtgtatatcctagactcggcgaccggggaggcccgt
acgaaggtggcctcgttcccgcgccagaccatcaccgtcgcggcgggccacaaggtctcg
gtgaatgcttcgaccactgtcaagaagccagcactgtggggtccaccgccctcgcagtcg
ccgaatatgcatgttgctgtaacgcgtttatataaccgcaacaacgacatcgttgacacg
tacttgaccgactttggcatccgctcggtcgtctatgacgccgatcatggcttgctggtt
aacggcgagcggatccggatccagggcgtgaacggccaccacgatctcggcgcgctcggg
gccgccttcaacgtgcgcgcggccgaacgccagctcgaagtgctccaggaactaggctgc
aacgctctccgtgtttcccacaacccccctgctcccgaactgctggatctggcagatagg
atgggcatcctgatctatgacgaggcgttcgacggctggcagctgtccaagaacccgaac
gacttccaccttatcttcgacgattggtccgaggccgaccttcgcgccatggtgcgccgc
gaccgtaaccacccgtctgtcatcatctggagcattggcaacgaggtcggggagcagacc
acgggcgacagcggcgctgccgtggccaggcggctacgccagatcgtccgctccgaggac
gagacgcgccccgtaacggcgtccatgaacgcggcccggccgaacatgcccttcccgggg
gagctcgacctgatcagcctcaactaccaaggcgagggcatccgtgatacgggcccgtac
gccggtctgccgggcatcagtacgccgccgctctacctccccttccacgacgccttcccg
gacaagttgatcgtcagcagcgagacggcggcaaccgtaagcacccgcgggacctacttc
ttccccatcaccaactggacgagcgcccccgcgaactacacggtcgggagcggcggcaac
gacacgctgctccaggtgagcgattacggcctgtatacggccccgtttggctcgtcgccc
gacaaggtattcgtggcgcaggacaacgcgtcctttgtgtccggggagtttgtctggtcc
ggctgggactacatcggcgagcccacgccgtactacgcggcgcggagctcgtactttggc
atcatcgacctggccgggttcaagaaggaccgcttctaccagtaccaggcccgctggcgg
ccagaccaccccgtcgcccacatcctgccgcactggacctggggggccgaccgcgtcggc
gaagtcacgcccgtccacgtcttctccaacggcgaccaggccgagctgtgggtcaacggc
aagtcgcagggccgtctgcggcgcgagtccgagtccgtctaccgcttccgctgggacaac
gtcacctaccagcccggcgaggtgcgcgttgtcacgtacaggaacggcaagcagtgggcc
agcgatagggtggtgacggcgggagtgcccgtggcccttcgcctgagagcggaccggtcc
gcgatcgcgggcgacgggcttgacctgtcattcttgacggccacggtggtggacagcaag
ggcaatgtggtgccgcaggcggataacgagattaccttcaccgtgtcgggtcgcggcggt
ggcgagatcgtggcgacggataacggcgacccccgggatttcacatcatttgcgtccagg
acgcgcaaggcctttagcgggcttgccttggggattgtgcgtgccaaccggaagggagat
atcacggtcacggctagcgcgcccggccttgcccgcgccgtggtcaagttgacggcaaat
tga

DBGET integrated database retrieval system