KEGG   Thermothelomyces thermophila: MYCTH_66068Help
Entry
MYCTH_66068       CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
mtm  Thermothelomyces thermophila
Brite
Translation factors [BR:mtm03012]
 Eukaryotic Type
  Elongation factors
   MYCTH_66068
 Prokaryotic Type
   MYCTH_66068
Mitochondrial biogenesis [BR:mtm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MYCTH_66068
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCTH_66068
  Exosomal proteins of breast cancer cells
   MYCTH_66068
  Exosomal proteins of colorectal cancer cells
   MYCTH_66068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 11512141
NCBI-ProteinID: XP_003661462
JGI: 66068
UniProt: G2Q8G8
LinkDB All DBs
Position
2:join(1762009..1762177,1762234..1762262,1762326..1763459)
Genome map
AA seq 443 aa AA seqDB search
MPASLRTFTPLLRAARLSLRQSQSPLVSLQRESRTPVLNFARAYAVYERTKPHVNIGTIG
HVDHGKTTLSAAITKRQAEKGLANYLDYGSIDKAPEERKRGITISTSHIEYSTEKRHYSH
VDCPGHADYIKNMITGAASMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFVNKVD
AIEDAEMLELVEMEMRELLNSYGFDGENTPVVLGSALCALEGKRPEIGEQKIDELMNAVD
EWIPTPERDTEKPFLLSIEDVFSIGGRGTVVSGRVERGVLKRDADVEIIGKGTEVIKTKV
TDIETFKKSCDESRAGDNSGLLLRGVRREDIKRGMVVAAPGTVTAHKKFLLSLYALTKEE
GGRHTGFHQNYRPQMFIRSADEACTLTFPEGTEDPDSKMVMPGDNVEMVAEIHKPIALEA
GMRVTIREGGRTVATGLITRIIE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctcgttgcggaccttcaccccgcttctgcgggcggcgcgcctctctctccga
cagtcccagagccctctggtctcgctgcagcgcgaatccaggacaccggtgctcaacttt
gcccgcgcctacgccgtctacgagcgcaccaagcctcacgtcaacatcggcacaattggc
cacgtcgatcacggaaagacgaccctgtccgccgctatcaccaagaggcaagccgagaag
ggcctggcgaactacctcgactatggctcaatcgacaaggctcccgaggagcggaagcgt
ggtatcaccatctcgacctcccacatcgagtactcgaccgagaagaggcactactcgcac
gtcgactgcccgggtcacgctgattacatcaagaacatgatcaccggtgccgcctccatg
gacggcgccatcattgtcgtcgccgcctcggacggtcagatgccgcagacccgtgaacac
ttgctgctcgcccgccaggtcggtgtccagaagatcgttgtcttcgtcaacaaggtcgac
gctatcgaggacgccgagatgctggagcttgtcgagatggagatgcgcgagcttctcaat
tcctacggcttcgacggcgagaacacccccgtcgttctcggctccgccctctgcgccctc
gagggcaagcgccctgaaattggcgagcagaagatcgacgagctcatgaacgccgtcgac
gagtggatccccacccccgagcgtgacaccgaaaagcccttccttctctccatcgaggat
gtcttctccattggtgggcgtggtaccgtcgtctcgggccgtgtggagcgtggtgtcctg
aagagggatgctgatgtcgagatcatcggcaagggcaccgaggtcatcaagaccaaggtc
accgacattgagacctttaagaagtcttgcgacgagtcgcgtgctggtgacaactccggc
ctcctcctccgtggcgtccgccgcgaggacatcaagcgcggcatggttgtcgccgcgccc
ggcaccgtcactgctcacaagaagttccttctctcgctctacgcgctcaccaaggaggaa
ggcggtcgccataccggcttccaccagaactatcgcccccagatgttcatccgctccgcc
gatgaggcttgcaccctcaccttccctgagggcaccgaggatcccgattcaaagatggtc
atgcccggtgacaatgtcgagatggtggccgagatccacaagcccatcgctctcgaggcc
ggtatgcgcgtcaccatccgcgagggtggccgcaccgttgccactggtctcatcacccgc
attatcgagtaa

DBGET integrated database retrieval system