KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_3352Help
Entry
ERDMAN_3352       CDS       T02526                                 

Gene name
ligB
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ERDMAN_3352 (ligB)
   03410 Base excision repair
    ERDMAN_3352 (ligB)
   03420 Nucleotide excision repair
    ERDMAN_3352 (ligB)
   03430 Mismatch repair
    ERDMAN_3352 (ligB)
Enzymes [BR:mtn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ERDMAN_3352 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     ERDMAN_3352 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ERDMAN_3352 (ligB)
DNA replication proteins [BR:mtn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ERDMAN_3352 (ligB)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ERDMAN_3352 (ligB)
DNA repair and recombination proteins [BR:mtn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ERDMAN_3352 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     ERDMAN_3352 (ligB)
   MMR (mismatch exicision repair)
    Other MMR factors
     ERDMAN_3352 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3411858..3413366
Genome map
AA seq 502 aa AA seqDB search
MAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGWAALRS
LPPPAPQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLRLLGGE
LRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRVGRPIG
PMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARLPEVVE
ATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHR
DGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKAPAA
RYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVMVGKTF
KGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLALRFARV
VRYRADKDPAEADTIDAVRALY
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcacctcaatggacgtggccgccacctcgtcgcggctgaccaaggtcgcgcgc
atcgccgccctgttgcaccgcgccgcgccagacacacagctggtcacgatcatcgtgtcg
tggctctccggcgagctgccgcaacgccatatcggtgtcgggtgggcggcattgcggtcc
ctaccgccgcccgcgccgcaaccggcgttgaccgtcaccggtgtcgacgccaccctctct
aagatcggcactctatcgggcaaagggtctcaggcgcagcgcgcggcactcgttgcggaa
ttgttctccgccgcaaccgaagctgagcaaacctttttgttgcgactgctcggcggtgaa
ctgcgccagggcgcaaagggcgggatcatggccgatgcggtcgcccaggccgccgggctc
ccggccgcgacggtccaacgcgccgcgatgctaggcggcgacctggcggcagcggcggcg
gccggcctgtccggcgcggcgctggacaccttcaccctgcgagtgggccgaccgataggc
ccgatgctggcacagaccgcgaccagcgtccatgatgcactcgaacgtcacggcggcaca
accattttcgaggctaaactagacggcgcgcgagtgcagatccaccgggcaaacgaccag
gtcaggatctacacccgaagcctggacgacgtcactgcccggctgcccgaggtggtggag
gcaacactggcactgccggtccgggatctagtggccgacggcgaggcgatcgcgctgtgc
ccggacaaccggccgcagcgtttccaggtcaccgcatcacggttcggccgatcggtcgat
gttgcggctgcccgcgcgacgcagccactttcggtgttcttcttcgacatcctgcatcgg
gatggtaccgacttgctcgaagcgccgaccaccgagcggctggccgccctggacgcactg
gtgccggctcggcaccgcgtggaccggctgatcacgtccgatccaacggacgcggccaac
ttcctggatgcgacgctggccgccggccacgagggggtgatggccaaggcaccggccgct
cgttaccttgcgggtcgccgcggagcgggctggctgaaggtcaagccggtgcacacactc
gacttggtggtgctcgcggtggaatggggctcgggacgccggcgcggcaagctctccaat
attcacctgggcgcacgcgatccggctaccggtggattcgtgatggtgggcaagaccttc
aaaggaatgaccgacgccatgctggactggcagaccaccaggtttcacgagatcgcggtg
ggtccgacagacggctacgtcgtccaacttaggcccgagcaggtggtcgaggtagccctc
gacggcgtgcaaaggtcgtcgcgctacccgggcgggctggcattgcggtttgcccgcgtg
gtgcgctaccgcgccgacaaggacccggccgaggccgacaccatcgatgccgtgcgcgcg
ctctactga

DBGET integrated database retrieval system