KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_0040Help
Entry
HKBS1_0040        CDS       T03154                                 

Gene name
fadD34
Definition
(GenBank) putative fatty-acid-coa ligase
Organism
mtq  Mycobacterium tuberculosis HKBS1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
38598..40286
Genome map
AA seq 562 aa AA seqDB search
MTAALLSPAIAWQQIWACTDRTLTISCEDSEVISYQDLIARAAACIPPLRRLDLKRGEPV
LITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLGPLLRHHRVLICTPAEH
DEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADWPLCTLDDDAYVQYTSGS
TAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHDMGLVGSLFAALFNSVSAV
FTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYHRRGADIEGIDLHKMRRLII
ASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAVSMSAPNTGFRTETHAAAEVV
TGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGGKKLDALDEEGFCDTHDLGFLV
DDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHRTKVACFGVNERVVVVLESPLDS
IIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTTSGKLKRRAVAQAYRDGTLPRLAT
HAWTADPDSAPKTTRSSLEGAH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggccttgctttcaccagccatcgcctggcagcagatctgggcttgcacggac
cgcacgctgacgatctcttgcgaggattccgaggtaatcagctatcaggacctcatcgcg
cgcgcggcggcatgcatccccccgctacggcgtcttgacctcaaacgcggtgaacccgtg
ctgatcaccgcccacaccaacctggaattcctgtcctgctttttgggcctcatgctccat
ggcgctgtgccggtacccatcccgccgcgggaggcactgaagaccaccgagcgtttcatg
actcggctcggcccactgctgcgccatcaccgcgtgctgatctgcacaccggccgaacac
gacgagatacgcgctgccgccagcaccgactgccagatcagcagatttactgccctagcc
gaggctggcgacgagcagttcggccgcgccacggcccagcaactcgccgacaccgccacc
gccgactggccgctatgcaccctcgacgacgacgcctacgtccaatacacctctggcagc
accgcagcaccacgcggagtggtcatcacctaccgcaacctgctgtccaacatgcgcgca
atggccgtgggctcacaattccagcacggcgatgtcatgggcagctggctgcccttgcac
catgacatggggctggtgggcagcctattcgccgcactcttcaacagtgtcagcgcggta
ttcaccacgccacaccggtttctgtatgacccgttgggattcctcagactgctcaccagc
tccggggctacccacacgttcatgcctaacttcgctctggagtggctgatcaacgcctac
cacaggcgcggcgccgacatcgaaggcatcgacctacacaaaatgcgccgcttgatcatc
gcctccgaacccgtccatgccgagggcatgcggagattcgccgccaccttcgccggcgtc
ggacttgcccccacggccctgggttcgggctatggcctggccgaagcgaccgtcgccgtg
tcgatgtcagcgcccaacacgggattccgcaccgaaacccacgccgccgcggaggtcgtc
accggcggccgagtgctgcctggctacgaggtgcgcattgacgccgcaccaggtgcccgg
gccggaacgatcaaactgcgcggcgacagcgtggccgccaaagcctatgtgggcgggaag
aagctggacgcgctcgacgaggaaggcttctgcgacacccacgacttgggttttcttgta
gacgacgaaatcgtcatccttggccggcaggacgaggtgttcattgtccacggagaaaac
agattcccctacgacatcgagttcatcattcgcggggaatccgagcagcaccggaccaaa
gtcgcatgtttcggggtcaacgaacgcgtcgtggttgtgttggaaagcccattggacagc
atcatcgacaaggccgaagccgaccgactgagatgtcaagtcgttgccgcgactgggctg
cagttggatgaactgatcacggttcggcgcggcgcgattcccaccaccaccagcggcaag
ctcaaacgacgcgccgtcgcgcaggcttatcgagacggcacactgccccgtcttgccacc
cacgcgtggacggcggatcccgatagcgctcccaaaacgacccggtccagcctggaaggc
gcccactga

DBGET integrated database retrieval system