KEGG   Medicago truncatula (barrel medic): MTR_0002s0660Help
Entry
MTR_0002s0660     CDS       T01716                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase large chain domain protein
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MTR_0002s0660
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_0002s0660
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MTR_0002s0660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MSPQTETKAGVGFQAGVKDYKLTYYTPEYETKDTDILAAFRVSPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEDSQWICYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREMTLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRAACKWSPELAAACEVWKAIKFEFEPVDTIDKKV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaggtgttggatttcaagctggtgttaaagattat
aaattgacttactacaccccagagtatgaaactaaggatactgatatcttggcagcattc
cgagtaagtcctcagcctggggttccgcccgaagaagcaggggctgcagtagctgccgaa
tcttctactggtacatggacaactgtttggactgatggacttaccagtcttgatcgttac
aaaggacgatgctatcacatcgagcctgttgctggggaagacagccaatggatctgttat
gtagcttatccattagacctatttgaggagggttccgttactaacatgtttacttccatt
gtgggtaacgtatttgggttcaaagccctacgtgctctacgtttggaggatctacgaatt
ccccctacttattcaaaaactttccaaggcccgcctcatggtatccaagttgaaagagat
aagttgaacaagtatggccgtcctttattgggatgtactattaaacctaaattgggttta
tccgctaaaaattacggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgctggagagaccgttttgtcttt
tgtgccgaagctatttataaatcacaggccgaaaccggtgaaatcaaggggcattacttg
aatgcgactgcgggtacatgtgaagaaatgattaagagagctgtatttgcgagagaatta
ggggttcctattgtaatgcatgactacttaaccgggggattcaccgcaaatactactttg
gctcactattgccgcgacaatggcttacttcttcacattcaccgtgcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tctgggggagatcatatccactccggtacagtagtaggtaagttagaaggggaacgcgaa
atgactttaggttttgttgatttattgcgcgatgattttattgaaaaagatcgtgctcgc
ggtatctttttcactcaggactgggtatccatgccaggtgttataccggtagcttcaggt
ggtattcatgtttggcatatgccagctctgaccgaaatctttggggacgattctgtatta
caatttggtggaggaactttaggacatccttgggggaatgcacctggtgcagcagctaat
cgagtggctttagaagcttgtgtacaagctcgtaacgaagggcgtgatcttgctcgcgaa
ggtaatgaaattatccgagcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
gtatggaaggcgatcaaattcgagttcgagccggtagatactatcgataagaaggtctaa

DBGET integrated database retrieval system