KEGG   Medicago truncatula (barrel medic): MTR_2g038030Help
Entry
MTR_2g038030      CDS       T01716                                 

Definition
(RefSeq) DNA ligase
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MTR_2g038030
Enzymes [BR:mtr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MTR_2g038030
DNA repair and recombination proteins [BR:mtr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MTR_2g038030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 883 aa AA seqDB search
MTELTKFSVLCSLFTWTQRTKAPAKKRAKFRKFLDNFCTDRNYFPAIRLILPNLDRERGS
YGLKESVLATSLIDALGMAKDSHDALRLVNWRKGGAKTGANAGNFALVAAEVLQLRQGTA
SGGLTIKELNDLLDQLSSSENRGEKTLVLSTLIQKTNALEMKWIIMIILKDLKLGISERS
IFHEFHPDAEDLFNVTCDLKLVCEKLRDRNQRHKRQDIEVGKAVRPQLAKRVANAADAWK
KLHGKEVVAECKFDGDRIQIHKNGTEIHFFSRNFIDHSEYAHGMSEIIIQNILVDRCILD
GEMLVWDTSLNRFAEFGSNQEIAKAARDGLESNRQLCYVAFDILYFGDTSVIHQTLKERH
EILRKVVKPLKGRFEILLPNGGINNHRSSGEPCWSFIAHNAEEVERFFKETIENREEGIV
VKDLSSKWEPSDRSGKWLKLKPDYVHAGSDLDVLIIGGYYGSGRHGGEVAQFLVGLAERP
SPNTHPKRFISLCRVGTGLSDDELEAVVTKLKPYFRKYPKTSPPSFYQVTNHSKERPDVW
VDSPEKSIILSVTSDIRTIESEAFAAPYSLRFPRIDRVRYDKDWHECLDVQSFIELVQSG
NGTTQRNTEYGSNKDSKPKRMKSSTRGEKKNMSTVPSHLSQTDVSSVTGGSLMFSNMMFY
FVNVPPSHSLESFHKLVAENGGTFSMNLNNAVTHCVAADSKGFKFEAAKRRGDIIHYTWV
LDCCAQKKLIPLHLKYFLFLSELTKKKLQEDIDEFSDSYYLDLDLGDIKQLLSNINRSED
VSTVDHYRKKYCPKDKWSIFNGCSIYFRTTMPSLKEDWQILLELSSKRFKVEVLMGGGKV
TSNLNSATHVVALFLPSCHTNYEDEIQISLQLRENFLEERGCI
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacttacaaaattcagcgtcctatgcagcctctttacatggacacaacgaaca
aaagcaccagcgaagaaacgcgcaaagttccggaagtttctggacaacttctgcactgat
cggaactattttccggccattcgactcattctacctaaccttgatcgtgaacgtggttct
tatgggcttaaagaatctgttcttgctacttctcttattgatgctcttggaatggcgaaa
gactcgcacgatgctcttaggcttgttaattggaggaaaggtggtgccaaaactggtgct
aatgccggtaatttcgcgcttgtcgccgcagaggtgctgcagcttaggcaaggtactgct
tcaggtggactgacaataaaggagttgaatgacttgcttgatcaattgtcttcgagcgaa
aacaggggtgagaagactttggttctttcaacccttatccaaaagacaaatgcgctagaa
atgaagtggatcatcatgataatcctcaaagatttgaagctcggaattagtgaaagaagc
atttttcatgaatttcatccagatgctgaagacttgttcaatgttacgtgtgacttaaaa
ctagtttgtgagaagctaagggatcggaaccaacgtcataagcggcaggatattgaagtt
ggaaaagctgtgcgtcctcaattagctaagagagttgctaacgcagctgacgcatggaag
aagcttcatggtaaggaagtggttgctgagtgcaaatttgacggtgatcgcattcaaatt
cataaaaatggaacggagatacattttttctcaaggaactttattgatcattctgaatat
gctcatgggatgtcagaaatcataattcaaaacattcttgtcgatagatgcatacttgat
ggtgaaatgttggtctgggatacatccttgaatcgatttgctgagtttggctctaatcag
gaaatagccaaggcagcaagggatgggcttgagagtaatagacagttatgctatgtggca
tttgacatcctttattttggagataccagtgtaattcatcaaacattgaaggagcggcat
gagattttacgtaaagttgttaagccattgaaaggtcgttttgaaattttactacctaat
ggtggtatcaacaatcatcggtcttctggtgaaccatgttggtcgtttattgctcacaat
gcggaggaagttgaaagatttttcaaagaaaccattgaaaatagagaggagggaattgta
gtaaaagacctcagctccaaatgggaacctagtgaccgcagtggaaaatggctaaagttg
aagcctgattacgttcatgctggctctgatctggacgtacttatcataggtggctactat
ggttccggacgacatgggggagaggttgctcaattcttggtgggccttgcagagcgtcca
tcaccaaatacacatcccaagcgatttatctccttatgcagagttggtactggactttct
gatgatgagcttgaagcagtagtgaccaaactaaaaccttacttcagaaagtatccaaag
acgagcccgccaagtttttatcaagttactaatcattccaaagaaagacctgatgtgtgg
gtcgatagccctgaaaaatcaattattctgtctgtaaccagtgacatccgaaccatagaa
tcagaggcattcgctgcaccttactctctgagatttcctcggattgacagggtgagatat
gacaaggattggcatgaatgccttgatgtacaatcatttatagaattggtgcaatctggc
aacggtaccacacagaggaatacagaatatgggagcaacaaggacagtaaaccaaaacgc
atgaaatcctctacaaggggagaaaagaaaaacatgtctactgttccctctcatttaagt
cagactgatgtttccagtgttacgggaggttccttaatgttttcaaatatgatgttctac
tttgttaatgtccctccatctcattcgctagagtccttccacaaattagttgctgagaat
gggggcactttctcaatgaatttaaataacgcagtcactcattgtgttgcagcagatagc
aaagggtttaaatttgaagcagcaaaacgtcgtggtgatatcattcattatacttgggta
ttagattgctgtgcacaaaagaagctcatccccttacatctgaagtacttcctctttctt
tctgaactgaccaagaagaagttacaagaagatattgatgagttctcggactcttactac
ttggatctcgaccttggagacatcaaacagctcttaagtaatattaataggtcagaagat
gtcagtactgtcgaccattacaggaaaaaatactgcccaaaggataagtggtctatcttt
aatggatgctccatttatttccgcaccacaatgccatcattgaaagaagattggcaaatt
ctattggaactttcctcgaagagattcaaagttgaagttctcatgggtggtggaaaagtc
acatctaatctcaactccgcaactcatgtggtggccttgttcttaccaagttgtcatacc
aactatgaagacgaaatacagatttcacttcagttgagagaaaacttcttggaagaaaga
ggttgcatataa

DBGET integrated database retrieval system