KEGG   Medicago truncatula (barrel medic): MTR_7g021770Help
Entry
MTR_7g021770      CDS       T01716                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase large chain domain protein
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MTR_7g021770
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MTR_7g021770
Enzymes [BR:mtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MTR_7g021770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 475 aa AA seqDB search
MSPQTETKATVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVSPQPGVPAEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAA
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREATKWSPELAAACEVWKEIKFELPAMDTI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaacggttgggttcaaagctggtgttaaagattat
cgattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattc
cgagtaagtcctcaacctggagttccggctgaagaagcaggtgcagcggtagctgccgaa
tcttccactgggacatggacaaccgtgtggaccgatggacttaccagtcttgatcgttat
aaaggacgctgctaccacatcgaacctgttgctggagaagagagtcaatttattgcttat
gtagcttatcccttagacctttttgaagaaggttctgttactaacatgtttacctccatt
gtaggtaatgtatttgggttcaaggccttgcgtgctctacgtctggaagatttgcgaatc
cccgttgcttatgttaaaactttccaaggtcctcctcacggaatccaagttgagagagat
aaattgaacaaatatggacgtcccctattgggatgtactattaaacctaaattgggttta
tccgctaaaaattacggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgaaaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaagcacaggccgaaactggtgaaatcaaaggacattatttg
aatgctactgctggcacctgtgaagacatgatgaaaagagctgtatttgctagagaattg
ggcgtgcctatcgtaatgcatgactacttaaccggtggattcactgcaaatactaccttg
gctcactattgccgcgataatggtctacttcttcatatccaccgtgcaatgcatgcagct
attgatagacagaaaaatcatggtatgcactttcgtgtattagctaaagcgttacgtatg
tcaggtggagatcatattcacgctggtactgtagtaggtaaactggaaggagaaagggat
attactttaggttttgttgatttactacgtgatgattttgttgaaaaagatagaagtcgc
ggtatttttttcactcaggattgggtttctttacctggtgttctgcctgttgcttcaggt
ggtattcatgtttggcatatgcctgctctgaccgagatatttggagatgattctgtactt
caattcggtggaggaactttaggacacccttggggaaatgcacctggtgccgtagcgaat
cgagtagctctggaagcatgtgtacaagctcgtaatgaaggacgtgatcttgctcgtgag
ggtaatgaaattatccgtgaagctaccaaatggagtcctgaattagctgctgcttgtgaa
gtctggaaggagatcaaatttgaactcccagcaatggatactatttaa

DBGET integrated database retrieval system