KEGG   Medicago truncatula (barrel medic): MTR_8g102460Help
Entry
MTR_8g102460      CDS       T01716                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_8g102460
   00051 Fructose and mannose metabolism
    MTR_8g102460
   00052 Galactose metabolism
    MTR_8g102460
   00500 Starch and sucrose metabolism
    MTR_8g102460
   00520 Amino sugar and nucleotide sugar metabolism
    MTR_8g102460
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MTR_8g102460
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MTR_8g102460
Membrane trafficking [BR:mtr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MTR_8g102460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLAD
AMDVEMHAGLASEGGSKLSMLISYVDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKG
VISQEFDEVSIPPQLMTGSSEGLFDFIAAALAKFVESEPEGFHPPPGRQRELGFTFSFPV
KQTSIASGTLIKWTKGFSIDDTVGEDVVGELTKSLEKIGLDMRVAALVNDTIGTLAGGRF
YNQDVIAAVILGTGTNAAYVEHAHAIPKWHGLMPKSGDMVINMEWGNFRSSHLPLTEYDQ
DLDAESLNPGEQIFEKLLSGMYLGEIVRRALLKMAEEAEFFGDTVPPKLKIPFILRTPDM
SSMHHDTTPDLKEVGSKLRDILEISNTSLKMRKIVVELCDIVASRGARLAAAGILGILKK
LGRDTVKGGEKQKSVIALDGGLFEHYTKFRVCLEDTLKELLGDEAAETVVVEHANDGSGI
GAALLAASHSQYLGVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggtcgcggtgggagctgcggttgtttgtgctgccgccgtttgtgccgcggcg
gcacttgtggtgcgccaccgtatgataagttcgagaaagtggacacgtagcgtgtctatt
ttgaaggagtttggggaaaagtgtgagacaccaattggaaagcttagacagttggctgat
gctatggatgttgagatgcatgctggtcttgcatctgaaggtggcagcaagcttagcatg
ttaatcagctatgttgataatcttcctactggggatgaggaaggactctattatgctcta
gatcttggtggaacaaacttccgtgtccttcgtgtacatttaggtggaaaagagaaaggt
gtcattagccaagagtttgatgaagtttcaattcctcctcaattgatgaccggttcttca
gagggattatttgattttatagcagcagctctcgcaaaatttgttgagtcagaacctgaa
ggttttcatcctccacctggcagacaaagagagctcggttttacattctcgttccctgtg
aagcaaacctcaattgcatctgggactctaataaagtggactaagggtttcagtattgat
gataccgttggcgaagatgtggtgggagaactaaccaagtccttggaaaaaattggcctg
gatatgcgtgttgcagctctagttaatgatacaattggaacattggctggaggcagattc
tacaatcaggatgtcattgctgctgtgattctcggtactgggacaaatgcagcatatgta
gaacatgcacatgctattccaaaatggcatggccttatgccaaaatcaggagatatggtt
ataaacatggaatggggtaatttccgatcatcacatcttcctttaacagaatatgatcaa
gatcttgatgctgaaagcttaaaccctggagaacagatttttgagaaattgctttctggc
atgtacttgggggaaattgtacggagagctttgttgaagatggccgaagaggctgaattt
ttcggagatactgttccccctaagttgaaaattccttttatacttaggacacctgacatg
tcttccatgcaccacgacacaacaccagatttgaaagaggttggaagcaaattgagggat
atattggagatctctaatacatcactaaaaatgaggaagattgttgtggaactctgtgac
attgtagccagtcgcggtgcacgccttgctgctgctggtattttgggaatccttaagaaa
ctaggaagagacacagttaagggtggagagaagcaaaagtcagtgatagcattggatgga
gggttgtttgaacactacactaaattcagagtttgcttggaggatacgctgaaggaattg
cttggagatgaggcagctgaaaccgttgtcgttgagcatgctaatgatggttcaggcatt
ggagcagcgcttctagccgcttctcactctcagtatttgggagtagaagagtcctaa

DBGET integrated database retrieval system