KEGG   Mycobacterium tuberculosis H37Rv: Rv0101Help
Entry
Rv0101            CDS       T00015                                 

Gene name
nrp
Definition
(RefSeq) peptide synthetase Nrp
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
110001..117539
Genome map
AA seq 2512 aa AA seqDB search
MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAALHATVLDNPVQLCVL
ENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVRHTVHTDPNGYVTGLDV
HTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLREAHRRETAKVEESRGRLS
AVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNAFDAILTLSEAQRVPLNVL
VAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVNSVAQTVRFPPFASVSDVVR
TLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNFIREPCAPGLRPFLSEVPIAT
DIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPKVAERIAAALESMAAMWDRPIA
MIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDSARGVHQFLGRRRFVYPWVAWLVQRGA
APGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTADEISVRTNAITEHGDGILVTVVDV
AATQLAVVGHDELRKVVDERVTQVTHDALLATKTAYIMPTSGTTGQPKLVRISHGSLAVF
CDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGAACGARLVRSAAMKTGDLAALVDDLV
ARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQIVIGGEAIRCSAVDKWLESAASQGIS
LLSSYGPTEATVVATFLPIVCDQTTMDGALLRLGRPILPNTVFLAFGEVVIVGDLVADGY
LGIDGDGFGTVTAADGSRRRAFATGDRVTVDAEGFPVFSGRKDAVVKISGKRVDIAEVTR
RIAEDPAVSDVAVELHSGSLGVWFKSQRTREGEQDAAAATRIRLVLVSLGVSSFFVVGVP
NIPRKPNGKIDSDNLPRLPQWSAAGLNTAETGQRAAGLSQIWSRQLGRAIGPDSSLLGEG
IGSLDLIRILPETRRYLGWRLSLLDLIGADTAANLADYAPTPDAPTGEDRFRPLVAAQRP
AAIPLSFAQRRLWFLDQLQRPAPVYNMAVALRLRGYLDTEALGAAVADVVGRHESLRTVF
PAVDGVPRQLVIEARRADLGCDIVDATAWPADRLQRAIEEAARHSFDLATEIPLRTWLFR
IADDEHVLVAVAHHIAADGWSVAPLTADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQRE
ILGDLDDSDSPIAAQLAYWENALAGMPERLRLPTARPYPPVADQRGASLVVDWPASVQQQ
VRRIARQHNATSFMVVAAGLAVLLSKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVL
RVNLAGDPSFAELLGQVRARSLAAYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDN
PVGQLNLGDLQATPMPIDTRTARMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAID
VLIERLRKVLVAVAAAPERTVSSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAA
QVARIPEAEAVCCGDASMTYRELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMV
AVLKTGAAYLPIDPANPPPRVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAY
PGTPPPMPAAVNLAYILYTSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYG
FDASAWEIWGALLGGGRLVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLE
SVALVVAGEACPAALVDRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGA
ALFVLDSWLRPVPAGVAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDL
VCWRADGQLEFLGRTDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVG
YATEIAPGAVDPAGLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTN
GYRAPAGPVEKTVAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVR
ALLHASSTRGLSQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNL
PGPSPELRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSG
DPELLRHFKELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHEL
FGPNVAGTAELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWA
GGYGTSKWAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATG
IAPRSFYEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGI
GLDEYVDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPL
KPTRGCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL
NT seq 7539 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgagttcggttaagccgctcgcagcgcaacctctacaacggcgtgcgccaggat
aacaatcccgcgttatatctgatcggcaagagctatcggttccgccggttggagctggcg
agattcctggccgctctgcacgcaacggtactggacaaccccgtgcaactttgcgtcctg
gagaattcgggggcagactatccggatctggtgccgcggctacggttcggcgacatcgtg
cgggtggggtcagccgatgagcacctgcagagcacatggtgttcgggcatcctgggcaag
ccactggtgcggcatacggtgcacaccgacccgaacgggtatgtgaccggtctggacgtt
cacacccaccacatcctgctggacggcggcgcgaccgggacgatcgaagctgacctggcg
cgttacctgaccaccgacccggcgggcgaaacccccagtgtcggtgcgggtctagccaag
ctcagggaggcgcaccgtcgtgagacggccaaggtggaagaatcgcgggggcgcctgtcg
gctgtcgtgcagcgtgaactcgccgacgaagcataccacggcgggcacgggcacagcgtt
agcgacgctcccgggaccgcggccaagggcgtcctgcacgaatcggcaacgatctgcggc
aacgcgtttgatgccatcctgaccctttcggaagcgcagcgggtcccgcttaatgtgctg
gtggctgcggcggccgtcgcggtggacgcgagccttcggcagaacaccgaaaccctcttg
gtgcacacggtggacaaccggttcggagattctgatctgaatgtcgcgacctgtttggtc
aattcggttgcccagaccgtccggtttcccccatttgcgtcggtgtccgatgtcgttcga
acgcttgaccgcggctatgtcaaggcggtaagacgccggtggcttcgtgaggagcattac
cgccgaatgtatttggcgatcaaccggacatctcacgtggaggcgttgacgctaaatttc
attcgcgagccatgcgcacctggcctgcgcccgttcttgtcggaggtcccgattgccacg
gatatcggtccggtcgagggcatgacggtggcgtctgttctggacgaagaacagcgcaca
ctgaacctagccatctggaaccgagccgatctgcccgcgtgcaagacacaccccaaggtc
gcggaacggatagcggcagcgttggaatcgatggcggcgatgtgggatcggccgatcgcc
atgatcgtcaacgactggttcgggatcggcccggacgggactcgctgccaaggcgattgg
ccagcccgtcagccgtcgacgcccgcgtggtttctcgattccgcaaggggcgtccaccaa
tttctcggcaggcgccgcttcgtctacccgtgggtcgcgtggttggtgcaacgcggcgcc
gcaccgggtgatgttctggtgttcaccgacgacgacaccgacaagaccattgacctgctc
atcgcgtgtcaccttgcgggttgcgggtacagcgtctgcgacaccgctgacgaaatttcc
gtgcggaccaatgcgattaccgagcacggcgatggcatcttggtgacagtggtcgacgtg
gccgccacccagctggcggttgtcggccatgacgagctgcggaaggtcgttgacgagcgc
gtcacacaggtgacacacgacgcactgctggccaccaagaccgcctacatcatgccgacc
tcgggaactaccggacaacccaagctggtgcgaatctcacacggctcgctcgcggttttc
tgtgatgcgatcagccgcgcctacggttggggagcccacgacaccgttctgcagtgcgct
ccgttgacatcggacatcagcgtcgaggagattttcggtggcgcggcctgtggcgcgcga
ctggtgcgatccgcggctatgaaaaccggcgacctggcggcgctggttgacgatctcgtc
gcccgcgagacgacaatcgtcgacctgccgaccgccgtctggcagctgttgtgcgccgac
ggcgacgccattgacgcgatcggccgctcgcgcctgcggcagatcgtaatcggcggtgaa
gccatccgctgtagcgccgtggacaagtggcttgaatcggctgcttcacaagggatctcg
ctgctctcgagctatggtccaacagaagccacggtcgtcgccaccttcttgccgatcgtt
tgcgaccagaccaccatggacggcgcactgctcaggctcggccggccgatcctaccgaac
acggtgttcctcgcgttcggtgaagtcgtcattgtcggggatttagtcgccgacggctac
ctcgggatcgacggcgacggcttcggcaccgtgacggccgcagacggttcccgacgccgt
gcctttgccactggcgaccgggtgaccgtcgacgccgaaggatttccggtcttctccgga
cgcaaagacgccgtcgtcaagatctccggcaagcgtgtcgatatcgctgaggtaaccagg
cgcatcgccgaagaccccgcggtgtcagatgtcgccgtcgagttgcacagcggaagcctc
ggagtgtggttcaagagccaacggacccgcgagggcgaacaagacgctgccgcggcgacc
cggatcaggctcgtcctcgtgagtctgggagtgtcgtcgtttttcgttgtcggcgtgccg
aatatcccgaggaagcccaacgggaagatcgacagcgacaacctgccgaggctgcctcag
tggtcagctgctgggctaaacaccgccgagacgggtcagcgagcggccggcctctcgcag
atctggagccggcagctcggccgggcaatcgggccggactcgtcgctgcttggtgagggc
atcggctcgttggatctcatcagaatactgcccgagacgcgtaggtatctggggtggcgc
ctctcgctgctggatctgatcggtgccgataccgccgccaatctggccgattacgcgcca
acgcccgacgcgccgacgggcgaagatcggtttaggccgctggtggccgcgcaacggccc
gcggcgattccgttgtcgtttgcccagcggcgactatggtttctcgaccagttacagcga
cccgctccggtctacaacatggcggtggcgttgcggctgcgcgggtatctcgataccgag
gcgttgggcgcggcggtcgccgatgtcgtgggccgccacgaaagcctacggacggtgttt
ccggcggtcgacggggtccctcggcagctggtcatcgaagcgcggcgggcagatcttggc
tgcgacatcgtcgatgccaccgcatggccggctgaccggctgcaacgggccatcgaggag
gcggcgcgccacagcttcgatttggcaaccgagatacctttgcggacgtggcttttccgg
atcgccgacgacgaacatgtgctggtggcggttgcacaccatatcgccgccgacggctgg
tcggtggctccgctgacggccgatctgagtgcggcatatgccagccgttgtgcgggtcgg
gcaccggactgggcgccattgccagtgcagtatgtcgattacacgctgtggcagcgggaa
atcctcggtgatctcgacgacagcgacagcccgatcgccgcgcagctggcctactgggaa
aatgcgttggccggtatgccggaacggctgcggctgcccaccgctcggccctatccaccg
gttgccgatcagcgcggcgccagtttggtggtggattggccggcgtcggtgcaacagcag
gtgcgtcggatcgcccgccagcacaacgcgaccagcttcatggtggtagctgccgggctt
gccgtgctgctgtcgaaactcagcggaagccccgatgtggcggtcggatttcccatcgcc
ggccgcagcgatcctgcgctggataacttggtgggcttttttgtcaacaccttggtgttg
cgggtcaacctggccggtgatcccagcttcgccgaactgctggggcaggtgcgagcgcgc
agcctggccgcctacgaaaatcaagacgtacctttcgaggtgctcgttgatcgcctcaaa
cccactcgagccctgacccatcacccgctgatccaggtgatgttggcctggcaggacaat
ccggttggacagctgaatttgggtgatctgcaggccaccccgatgccgatcgacacccgc
accgcccgcatggacttggtgttttcgttagcggaacgcttcagcgagggtagcgaacct
gccgggatcggcggagcggtggaataccgcaccgatgtgtttgaagcccaagcaatcgac
gtgcttatcgagcggttgcggaaggtgttggtggcggtggccgctgctccggaacggacg
gtgtcgtcgatcgatgcgctggatgggaccgagcgtgcccggttggatgagtggggtaac
cgcgctgtgctgactgcgcccgcgcccacgccggtgtcgatcccgcagatgttggccgcc
caggtggcacgtatccccgaagcggaggcggtgtgttgcggggacgcgtcgatgacgtat
cgggaactcgacgaggcgtccaaccggttagcgcatcggctggcaggttgtggggccggc
ccgggcgagtgtgtggcgctgctgttcgagcggtgcgcgccggcggtcgtggcgatggtg
gcagtgctcaaaaccggggcggcgtatctgccgatcgatccggcgaatcctccgccgcgg
gtggcgttcatgctcggcgacgcggtgcccgtggccgcggtcaccacggctgggctgcgc
tcccggttggcgggacacgacttgccgatcatcgatgtcgtcgatgctttagcggcatat
ccgggcacgcccccacccatgccggccgcagtgaacctcgcctacatcctgtacacctcg
ggcactaccggcgagcccaaaggcgtggggatcacccatcgcaacgtcaccaggctgttc
gcatcactgccggcacgcttgtcggcggcgcaggtgtggtcgcagtgtcattcctatggc
ttcgacgcctcggcgtgggagatctggggcgcgttgctaggtggtgggcgactggtgatc
gtgcccgagtcggtggcggcctcgccgaacgactttcatgggctgctcgtggccgaacac
gtcagcgtgctgactcagactccggctgcggtggcaatgttgccgacgcagggtttggag
tcggtggcgttggtggtggccggtgaggcatgtccggcagcgctggtggatcggtgggcg
cccgggcgggtgatgctaaatgcttatggcccaaccgagaccacgatctgtgcggcgata
agtgcgccgttgcgaccgggttcggggatgccgccgattggtgttccggtgtcgggggcg
gcgttgtttgtgctggatagctggttgcgcccggtaccggccggggtggccggagagttg
tacattgccggtgcgggcgtcggtgttgggtattggcgtcgggcggggctgaccgcgtca
cggtttgtggcctgcccattcggcggttccggggcacgcatgtatcgcaccggggatctg
gtgtgttggcgcgccgatggccagttggagttcctggggcgcaccgacgatcaggtcaag
atccgcgggtatcgcatcgagctcggcgaggttgcgaccgcgctggccgagctggctggg
gtaggtcaagcggttgtaatcgcccgtgaagaccgccctggggacaagcgcctagtcggg
tatgccaccgaaattgcccccggggcagtggacccggccgggctgcgggcgcaactagcc
cagcgattgcccggttacctggtgccagccgcggtggtagtgatcgatgcgcttccgttg
acggtcaacggcaaacttgatcatcgtgcgttgccggcaccggaatacggtgataccaac
ggatatcgcgctccggccgggccggttgagaagaccgtggccggcatctttgcccgggtt
cttgggcttgagcgggtcggcgtcgacgactcgttcttcgagctcggcggcgattcgctg
gcggcaatgcgggttatcgccgcgatcaacaccaccctaaacgccgatctgccggtgcgc
gcgttgctgcacgcgtcgtcgacgagaggtttaagccagctgttggggcgagatgcccga
ccgaccagcgatccgcgcttggtgtctgtgcacggcgacaaccccaccgaggtgcatgcc
agcgacctcacgctggaccggttcatcgacgccgacacgctggccaccgccgtcaacctg
ccgggcccgagccccgagctacggacggtcctgctgacgggcgcgacgggtttcctcgga
cggtatctggtccttgaattgctgcggcggctggacgtcgacggcaggctgatctgtttg
gtgcgggcggagtccgacgaggatgcgcggcgtcgtctggagaagaccttcgatagcggt
gacccggaattgctgcggcacttcaaggagcttgccgccgaccggctggaggtcgtcgca
ggcgacaagagcgaacccgacctgggcctggaccaaccgatgtggcggcggctggccgaa
accgtggatttgattgtcgattccgcggcgatggtcaacgcgtttccctaccacgaattg
ttcgggcccaacgtcgcgggcaccgccgagctgatccgaatcgcgcttaccaccaagctc
aaacccttcacctacgtgtcaaccgccgacgtgggtgctgcgatcgagccgtcggcgttc
accgaggacgccgacatccgggtaatcagccccacccgcaccgtcgacggcggctgggct
ggcggctacggcaccagcaagtgggccggtgaggtgctgctgcgcgaggccaacgacctg
tgcgcgctgccggtcgcggtgtttcgctgcgggatgatcctggccgacaccagctatgcc
ggacagctcaacatgtcggactgggtcacccggatggtgttgagcttgatggctaccggc
atcgcgcctcgttcgttctacgaaccggactccgagggcaatcggcaacgcgcgcacttc
gacgggctgccagtcaccttcgttgccgaggcgatcgcggtgctgggcgcgcgggtggcc
ggctcatcgttggcgggatttgcgacctatcacgtgatgaacccgcacgacgacggtatc
gggctcgatgagtatgtggactggctgattgaggccggctacccgatacgccgcatcgat
gactttgcggagtggttgcagcggtttgaggccagcctgggcgctctgccggatcggcaa
cgccggcactcggtgctgccgatgctgctggcgagcaattcccagcgattgcagccgctt
aagccgaccagggggtgctccgcgccgaccgaccgattccgtgccgcggtgcgagcggcg
aaagtcggctccgacaaggacaatccagacatcccgcacgtgtcggcgccgaccatcatc
aactacgtcaccaacctacaactgctcggactgctgtag

DBGET integrated database retrieval system