KEGG   Mycobacterium tuberculosis H37Rv: Rv0119Help
Entry
Rv0119            CDS       T00015                                 

Gene name
fadD7
Definition
(RefSeq) fatty-acid--CoA ligase FadD7
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
144049..145626
Genome map
AA seq 525 aa AA seqDB search
MASDFGPRIADLVEVAATRLPEAPALVVTADRIAISHRDLARLVDELAGQLTRSGLLPGD
RVALRMGSNAEFVVALLAASRADLVVVPLDPALPITEQRVRSQAAGARVVLIDADGPHDR
AEPTTRWWPLTVNVGGDSGPSGGTLSVHLDAATEPNPATSTPEGLRPDDAMIMFTGGTTG
LPKMVPWTHANIASSVRAIITGYRLSPRDATVAVMPLYHGHGLIASLLATLASGGAVSLP
ARGRFSAHTFWDDIKAVGATWYTAVPTIHQILLERSATEPSGRKPAALRFIRSCSAPLTA
QAALALQTEFAAPVVCAFGMTEATHQVTTTQIEGIDQTETPVVSTGLVGRSTGAQIRIVG
SDGLPLPAGAVGEIWLRGTTVVRGYLGDPTITAANFTDGWLRTGDLGSLSAAGDLSIRGR
IKELINRGGEKISPERVEGVLASHPNVMEAAVFGVPHQLYGEAVAAVIVPRESAPPTREE
LVQFCRERLAAFEIPASFQEASGLPHTAKGSLDRRAVAERFGHSV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgacttcggcccgcgcatcgccgatcttgtcgaggtggcggcgacccggctg
cccgaggctccggcgctcgtcgtcaccgcggatcgcatcgcgatcagccaccgcgacctg
gcccgtctggttgatgagctggccggccagctgacgcggtccggcctgctgcccggtgac
cgggtcgcgctgcgcatgggcagcaacgccgaattcgtcgtcgccttgctggcggcgtcg
cgtgcggatctcgtcgtcgtgccgctggatccggcgctgcccatcaccgagcaacgcgtc
cgaagccaggccgcgggagcccgggtggtgctgattgacgcggatgggccgcacgacagg
gcagaacccaccacccggtggtggccgctcacggtgaacgtcggcggtgacagcggcccc
tcgggtggcaccttgtcggtccacctggacgccgccaccgagccgaaccccgcaacctcg
acgcccgagggactgcgacccgatgacgccatgatcatgttcaccggcgggacgaccggc
ctgccgaagatggtcccctggacgcacgcaaacatcgccagctcggtccgcgccatcatc
accgggtaccggctgagcccgcgggacgccaccgttgcggtgatgccgctctaccatggc
cacgggctgatcgcgtcgttgcttgccaccctggcgtccggcggcgcggtgtcgctgccc
gcacgcgggcgattctccgcgcacaccttctgggacgacatcaaagccgttggagccacc
tggtatacggcggttccgacgattcaccaaatcctgctggagcgatcggcaaccgaaccg
tcggggcgcaaacctgccgcactgcgtttcatccgcagctgcagcgcaccgctcactgcc
caagccgcgctagcactgcaaaccgagttcgcggcaccggtcgtgtgtgccttcggcatg
accgaagccacccaccaggtaacgacaacgcagattgagggtatcgaccaaaccgaaact
cccgtcgtgtcaaccggtctggtcggccggtcgacgggagcgcaaatccggatcgtcggg
tccgacgggctgccactgcccgcgggcgcggtcggggagatctggctgcgggggaccacc
gtggtacgcgggtatctgggtgacccgacgataaccgccgcgaatttcaccgacggttgg
ttgcgtaccggtgatctcgggtccctgtcggcggccggtgacctgagcatccgcggccgc
atcaaggaactcatcaaccgaggtggtgaaaagatctcgcccgagcgcgtcgagggcgtg
ctggccagccatccaaacgtcatggaggcagccgtattcggcgtcccgcaccagctctac
ggcgaggcggtcgcggcggtgattgtgcctcgtgagtccgccccgccgactcgcgaggag
cttgtccagttctgccgggaacggttggcggccttcgagatcccggcctccttccaggag
gccagcgggctgccgcacaccgcgaagggttcgctcgaccgccgcgctgtcgccgaacgg
ttcggccattcggtgtag

DBGET integrated database retrieval system