KEGG   Mycobacterium tuberculosis H37Rv: Rv0404Help
Entry
Rv0404            CDS       T00015                                 

Gene name
fadD30
Definition
(RefSeq) long-chain-fatty-acid--AMP ligase FadD30
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
483977..485734
Genome map
AA seq 585 aa AA seqDB search
MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRVTAVSAYLISYGRHAD
RRRTAAISAPQGLDYVAGFLGALCAGWTPVPLPEPLGSLRDKRTGLAVLDCAADVVLTTS
QAETRVRATIATHGASVTTPVIALDTLDEPSGDNCDLDSQLSDWSSYLQYTSGSTANPRG
VVLSMRNVTENVDQIIRNYFRHEGGAPRLPSSVVSWLPLYHDMGLMVGLFIPLFVGCPVI
LTSPEAFIRKPARWMQLLAKHQAPFSAAPNFAFDLAVAKTSEEDMAGLDLGHVNTIINGA
EQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLATTKAGSPPTSTEFDADSLARG
HAELSTFETERATRLIRYHSDDKEPLLRIVDPDSNIELGPGRIGEIWIHGKNVSTGYHNA
DDALNRDKFQASIREASAGTPRSPWLRTGDLGFIVGDEFYIVGRMKDLIIQDGVNHYPDD
IETTVKEFTGGRVAAFSVSDDGVEHLVIAAEVRTEHGPDKVTIMDFSTIKRLVVSALSKL
HGLHVTDFLLVPPGALPKTTSGKISRAACAKQYGANKLQRVATFP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttatatccacgttgcgcgaccgtgcgaccacgactccaagcgacgaagccttt
gtgttcatggattacgacacaaaaaccggcgaccaaattgaccgaatgacgtggagtcaa
ttatattctcgcgtcaccgccgtgtctgcgtatctaataagttatggccggcatgctgac
cgacgaaggaccgcagcgatatcagctccgcaaggtctggactatgttgcaggatttcta
ggagcactgtgcgccggatggacgccggttccgttaccagaaccgctgggcagcctacgc
gataagcggactggactggctgtactcgactgtgccgccgacgtcgtgctgacgacgtcg
caagccgaaacgcgggtcagggccacgatagctacacatggggcgtctgtaactacgccg
gtcatagcgttggatacattggacgagccatccggagataactgtgatctcgattctcaa
ctatcagactggagttcgtatttgcagtatacttcgggttcaacggccaacccccgtggt
gtggttttatccatgcgtaacgttacggaaaatgtcgaccaaattatccgtaactatttt
cgccatgagggcggcgcgccgaggttgcccagctcggtcgtttcgtggttgccgctttac
catgacatgggtttaatggttggcctctttattccgttgtttgtcggatgtccggttatc
ctgacgagcccagaggcatttatccgtaagcctgccagatggatgcaactgcttgctaaa
caccaggcgccattttcggccgcgccgaacttcgcattcgatttggccgtcgctaaaact
tccgaagaggacatggcggggctggatttaggccacgtaaatacaataatcaacggcgcg
gagcaggtacagccaaatacaataaccaaattcctccgccggttccgtccctacaatttg
atgcccgcagcggtcaagccatcatacgggatggctgaagcggtggtttacctggcgacg
acgaaggcgggatcacctccaacgtcaaccgagttcgatgctgatagcttggctcgaggc
cacgcggagctaagtactttcgaaactgagcgtgcaacgcgtttaatacgctaccacagc
gacgacaaggaaccgttgcttcggattgtcgatccggactcgaatatcgagctcggaccg
ggacgtatcggcgagatttggattcacggtaagaatgtgtctaccggatatcacaatgca
gacgacgcgctcaatcgagataagttccaggccagcatccgggaggcctctgcgggaacg
ccaaggtcgccgtggcttcgcacgggagacttgggattcatagtaggagatgagttctac
atcgtcggccgtatgaaagatctcattatccaagacggtgtaaaccattatcccgatgat
atcgaaactacggtcaaggagtttaccggtggccgggtcgcggcattttcagtatccgac
gacggggtggagcatttggtcattgcggccgaggtaaggactgagcatgggcccgataaa
gtgactattatggatttctcgacgatcaaaaggctggtcgtatcggcgttgtcgaaatta
catggcctgcatgtaacagattttcttctggtaccgcccggggcgctaccgaagaccacc
agcggaaagattagccgggcggcatgcgcaaagcagtacggagcaaataagttgcaacga
gtagcaacgttcccatga

DBGET integrated database retrieval system