KEGG   Mycobacterium tuberculosis H37Rv: Rv1185cHelp
Entry
Rv1185c           CDS       T00015                                 

Gene name
fadD21
Definition
(RefSeq) fatty-acid--CoA ligase FadD21
  KO
K12423  
fatty acid CoA ligase FadD21
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Unknown
   Rv1185c (fadD21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
complement(1325776..1327512)
Genome map
AA seq 578 aa AA seqDB search
MSDSSVLSLLRERAGLQPDDAAFTYIDYEQDWAGITETLTWSEVFRRTRIVAHEVRRHCT
TGDRAVILAPQGLAYIAAFLGSMQAGAIAVPLSVPQIGSHDERVSAVLADASPSVILTTS
AVAEAVAEHIHRPNTNNVGPIIEIDSLDLTGNSPSFRVKDLPSAAYLQYTSGSTRAPAGV
MISHRNLQANFQQLMSNYFGDRNGVAPPDTTIVSWLPFYHDMGLVLGIIAPILGGYRSEL
TSPLAFLQRPARWLHSLANGSPSWSAAPNFAFELAVRKTTDADIEGLDLGNVLGITSGAE
RVHPNTLSRFCNRFAPYNFREDMIRPSYGLAEATLYVASRNSGDKPEVVYFEPDKLSTGS
ANRCEPKTGTPLLSYGMPTSPTVRIVDPDTCIECPAGTIGEIWVKGDNVAEGYWNKPDET
RHTFGAMLVHPSAGTPDGSWLRTGDLGFLSEDEMFIVGRMKDMLIVYGRNHYPEDIESTV
QEITGGRVAAISVPVDHTEKLVTVIELKLLGDSAGEAMDELDVIKNNVTAAISRSHGLNV
ADLVLVPPGSIPTTTSGKIRRAACVEQYRLQQFTRLDG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcttctgtcttgtccttgctgcgcgagcgtgccggcctgcagcccgacgac
gccgcgttcacgtacatcgactacgaacaggattgggccggcatcaccgagacgctcacg
tggtcagaggtgtttcgacggacccgcatcgttgctcacgaagtcaggcggcattgcacg
accggagaccgagccgtgattctggctccgcagggcctggcctacatcgcggctttccta
ggttcgatgcaggccggagcgatagcggttccgttgtcagtcccgcagatcggctctcac
gacgaacgtgtcagcgcggtgcttgccgacgcgtcaccttcggtcatcctgacaacatct
gcggtcgcagaagcggttgccgagcacatccaccggccgaacacgaacaacgtagggccg
atcatcgaaatcgattcattggacttgaccgggaattcaccgagctttcgggtgaaggat
ctgccaagcgccgcgtacttgcagtacacctctggctccacccgcgctccggctggggtc
atgatctcgcatcggaaccttcaggcgaatttccaacagctgatgtcgaactacttcggc
gaccgcaacggtgtggcgccacctgacactaccatcgtgtcgtggctgccgttctaccac
gacatgggcttggtccttggcatcatcgcaccgatcctgggcggctaccgcagtgaactc
actagcccgctggcgttcctgcaacggccagcgcgttggctacattcgctggccaacgga
agtccttcgtggtcggccgcaccgaatttcgccttcgaattggccgtccgcaagacaaca
gatgccgacatagaaggcctcgacctcggcaacgtcctgggcatcaccagtggtgctgaa
cgagtccaccccaacacgctcagtagattctgcaaccggtttgcaccgtacaatttccgc
gaagacatgatacggccttcgtacggtctggcggaagcgactctttatgtggccagccgc
aattcgggtgacaagccagaagtcgtctacttcgaacctgacaagctgtccacgggcagt
gcgaatcgatgtgaacccaagaccggcacaccgctgctgagctatggcatgccgacatca
ccaacagtgcgaattgtggatcccgacacctgcattgagtgccccgcgggaacgatcggc
gagatctgggtgaagggcgacaacgtcgccgaaggctactggaacaaaccggacgagaca
cggcacacctttggcgcaatgctggtccacccctcggcaggtactcctgatggatcctgg
ttgcgaacgggagacctcggattcctctccgaggacgagatgttcatcgtgggccgtatg
aaggacatgctgatcgtatacgggcgcaatcactaccccgaggacatcgagtcgaccgtc
caggagatcactggtggtcgggtcgctgcgatttcagttccggtcgatcacacagagaag
ttagtcactgtcatcgagctcaagctcctcggcgattccgccggcgaagcgatggacgaa
ctcgatgtcatcaagaacaacgtcacagccgcgatatcacgctcgcacggtctcaacgtg
gcggacctcgtcttggtcccgcccgggtcgatccccaccacaaccagcggcaagatcaga
agggccgcctgtgtagagcaataccggctgcagcaattcacccggttggacggctga

DBGET integrated database retrieval system