KEGG   Mycobacterium tuberculosis H37Rv: Rv1193Help
Entry
Rv1193            CDS       T00015                                 

Gene name
fadD36
Definition
(RefSeq) fatty-acid--CoA ligase FadD36
  KO
K12429  
fatty acid CoA ligase FadD36
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rv1193 (fadD36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
1335794..1337215
Genome map
AA seq 473 aa AA seqDB search
MLLASLNPAVVSAADIADAVRIDGDVLSRSDLVGAATSVAERVAGAHRVAVLATPTASTV
LAITGCLIAGVPVVPVPADVGVTERRHMLTDSGVQAWLGPLPDDPAGLPHIPVRTHARSW
HRYPEPSPGAIAMVVYTSGTTGPPKGVQLSRRAIAADLDALAEAWQWTAEDVLVHGLPLY
HVHGLVLGLLGSLRFGNRFVHTGKPTPAGYAQACYEAHGTLFFGVPTVWSRVAADQAAAG
ALKPARLLVSGSAALPVPVFDKLVQLTGHRPVERYGASESLITLSTRADGERRPGWVGLP
LAGVQTRLVDDDGGEVPHDGETVGKLQVRGPTLFDGYLNQPDATAAAFDADSWYRTGDVA
VVDGSGMHRIVGRESVDLIKSGGYRVGAGEIETVLLGHPDVAEAAVVGVPDDDLGQRIVA
YVVGSANVDADGLINFVAQQLSVHKRPREVRIVDALPRNALGKVLKKQLLSEG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctggcctccctgaatcctgctgtcgtctccgccgccgatatcgcggacgcggtc
cgcatcgacggcgacgtgctgagccgtagcgacctggtcggcgcggcaacgtcggtggcc
gagcgggtcgccggtgcgcaccgggtcgccgtgctggccacgccgaccgcgtcgacggtg
ctggcgatcaccggctgcctgatcgccggcgtgccggttgtgccggtacccgccgatgtg
ggcgtcaccgaacgccggcacatgctcaccgactccggcgtccaggcatggctgggcccg
ttgcccgacgacccagcggggctgccacacatcccggtgcgcacgcacgcgcggtcctgg
caccgttatccggagccctcacccggggccatcgccatggtggtctacacgtccggcacc
accgggccgcccaaaggcgtgcagctgagccggcgggcgatcgccgccgacctcgatgca
ttggcagaggcctggcagtggacggccgaggacgtgctggtccacggtctgccgctgtat
cacgttcacggcctggtgctgggcttgctcgggtcgctgcggttcggaaatcgcttcgtg
cacaccggtaaaccaacgccggccggctacgcccaggcctgttatgaagcgcacggcacg
ttgttttttggggtgccgacggtgtggtcacgagtggcggccgaccaagctgccgccggg
gcgctcaaaccggcgcggctgctggtgtccgggagtgcggcactacccgtgccggtgttc
gacaagctggtgcagctcaccgggcaccggcccgtcgaacgctacggtgcttcggagtcg
ctgatcaccctatcgacgcgggctgacggtgagcgtcgcccgggctgggtcggcctgccg
ctggccggtgtgcagacccgactggtggacgacgatggcggtgaggtcccgcacgacggg
gaaaccgttggaaagcttcaggttcgcggtccgaccctgttcgacggctacctgaatcaa
cccgatgccaccgccgcggcgttcgacgccgacagctggtaccgcaccggcgacgtcgcg
gtggtcgacggcagtgggatgcaccgcatcgtgggacgcgagtcggtcgacttgatcaag
tcgggtggataccgggtcggcgccggtgaaattgaaacggtgctgctcgggcatccggac
gtggcggaggcggcagtcgtcggggtgcccgacgatgatctaggccagcggatcgttgcc
tacgtagtcggctcagcgaatgtcgatgcggacgggcttatcaactttgttgcccaacaa
ctttcggtgcacaagcgcccgcgcgaggtgcgtatcgtagatgcgctgccgcgcaacgcg
ttggggaaagtgctcaagaagcagttgctgtcagaaggctga

DBGET integrated database retrieval system