KEGG   Mycobacterium tuberculosis H37Rv: Rv1206Help
Entry
Rv1206            CDS       T00015                                 

Gene name
fadD6
Definition
(RefSeq) fatty-acid--CoA ligase FadD6
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Rv1206 (fadD6)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Unknown
   Rv1206 (fadD6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
1349332..1351125
Genome map
AA seq 597 aa AA seqDB search
MSDYYGGAHTTVRLIDLATRMPRVLADTPVIVRGAMTGLLARPNSKASIGTVFQDRAARY
GDRVFLKFGDQQLTYRDANATANRYAAVLAARGVGPGDVVGIMLRNSPSTVLAMLATVKC
GAIAGMLNYHQRGEVLAHSLGLLDAKVLIAESDLVSAVAECGASRGRVAGDVLTVEDVER
FATTAPATNPASASAVQAKDTAFYIFTSGTTGFPKASVMTHHRWLRALAVFGGMGLRLKG
SDTLYSCLPLYHNNALTVAVSSVINSGATLALGKSFSASRFWDEVIANRATAFVYIGEIC
RYLLNQPAKPTDRAHQVRVICGNGLRPEIWDEFTTRFGVARVCEFYAASEGNSAFINIFN
VPRTAGVSPMPLAFVEYDLDTGDPLRDASGRVRRVPDGEPGLLLSRVNRLQPFDGYTDPV
ASEKKLVRNAFRDGDCWFNTGDVMSPQGMGHAAFVDRLGDTFRWKGENVATTQVEAALAS
DQTVEECTVYGVQIPRTGGRAGMAAITLRAGAEFDGQALARTVYGHLPGYALPLFVRVVG
SLAHTTTFKSRKVELRNQAYGADIEDPLYVLAGPDEGYVPYYAEYPEEVSLGRRPQG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgattactacggcggcgcacacacaacggtcaggctgatcgacctggcaactcgg
atgccgcgagtgttggcggacacgccggtgattgtgcgtggggcaatgaccgggctgctg
gcccggccgaattccaaggcgtcgatcggcacggtgttccaggaccgggccgctcgctac
ggtgaccgagtcttcctgaaattcggcgatcagcagctgacctaccgcgacgctaacgcc
accgccaaccggtacgccgcggtgttggccgcccgcggcgtcggccccggcgacgtcgtt
ggcatcatgttgcgtaactcacccagcacagtcttggcgatgctggccacggtcaagtgc
ggcgctatcgccggcatgctcaactaccaccagcgcggcgaggtgttggcgcacagcctg
ggtctgctggacgcgaaggtactgatcgcagagtccgacttggtcagcgccgtcgccgaa
tgcggcgcctcgcgcggccgggtagcgggcgacgtgctgaccgtcgaggacgtggagcga
ttcgccacaacggcgcccgccaccaacccggcgtcggcgtcggcggtgcaagccaaagac
accgcgttctacatcttcacctcgggcaccaccggatttcccaaggccagtgtcatgacg
catcatcggtggctgcgggcgctggccgtcttcggagggatggggctgcggctgaagggt
tccgacacgctctacagctgcctgccgctgtaccacaacaacgcgttaacggtcgcggtg
tcgtcggtgatcaattctggggcgaccctggcgctgggtaagtcgttttcggcgtcgcgg
ttctgggatgaggtgattgccaaccgggcgacggcgttcgtctacatcggcgaaatctgc
cgttatctgctcaaccagccggccaagccgaccgaccgtgcccaccaggtgcgggtgatc
tgcggtaacgggctgcggccggagatctgggatgagttcaccacccgcttcggggtcgcg
cgggtgtgcgagttctacgccgccagcgaaggcaactcggcctttatcaacatcttcaac
gtgcccaggaccgccggggtatcgccgatgccgcttgcctttgtggaatacgacctggac
accggcgatccgctgcgggatgcgagcgggcgagtgcgtcgggtacccgacggtgaaccc
ggcctgttgcttagccgggtcaaccggctgcagccgttcgacggctacaccgacccggtt
gccagcgaaaagaagttggtgcgcaacgcttttcgagatggcgactgttggttcaacacc
ggtgacgtgatgagcccgcagggcatgggccatgccgccttcgtcgatcggctgggcgac
accttccgctggaagggcgagaatgtcgccaccactcaggtcgaagcggcactggcctcc
gaccagaccgtcgaggagtgcacggtctacggcgtccagattccgcgcaccggcgggcgc
gccggaatggccgcgatcacactgcgcgctggcgccgaattcgacggccaggcgctggcc
cgaacggtttacggtcacttgcccggctatgcacttccgctctttgttcgggtagtgggg
tcgctggcgcacaccacgacgttcaagagtcgcaaggtggagttgcgcaaccaggcctat
ggcgccgacatcgaggatccgctgtacgtactggccggcccggacgaaggatatgtgccg
tactacgccgaataccctgaggaggtttcgctcggaaggcgaccgcagggctag

DBGET integrated database retrieval system