KEGG   Mycobacterium tuberculosis H37Rv: Rv1345Help
Entry
Rv1345            CDS       T00015                                 

Gene name
mbtM
Definition
(RefSeq) long-chain-fatty-acid--ACP ligase MbtM
  KO
K01909  
long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC:6.2.1.20]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Rv1345 (mbtM)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.20  long-chain-fatty-acid---[acyl-carrier-protein] ligase
     Rv1345 (mbtM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
1509281..1510846
Genome map
AA seq 521 aa AA seqDB search
MSELAAVLTRSMQASAGDLMVLDRETSLWCRHPWPEVHGLAESVAAWLLDHDRPAAVGLV
GEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADATLTRFLGIGVRTVLSQGSYLA
RLRSVDTAGVTIGDLSTAAHTNRSATPVASEGPAVLQGTAGSTGAPRTAILSPGAVLSNL
RGLNQRVGTDAATDVGCSWLPLYHDMGLAFVLSAALAGAPLWLAPTTAFTASPFRWLSWL
SDSGATMTAAPNFAYNLIGKYARRVSEVDLGALRVTLNGGEPVDCDGLTRFAEAMAPFGF
DAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPGMEVRISCGDQ
AAGNASREIGEIEIRGASMMAGYLGQQPIDPDDWFATGDLGYLGAGGLVVCGRAKEVISI
AGRNIFPTEVELVAAQVRGVREGAVVALGTGDRSTRPGLVVAAEFRGPDEANARAELIQR
VASECGIVPSDVVFVSPGSLPRTSSGKLRRLAVRRSLEMAD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctcgcggccgtgctcacgcggtccatgcaggcctctgccggcgacttgatg
gtcctcgaccgcgagacctcgctgtggtgtcggcacccgtggcccgaggtacacgggctg
gccgagagcgtagcggcctggctgctagaccatgaccgacccgccgcggtgggtctggtc
ggcgaaccgacggtcgagttggtcgccgcgatccagggtgcctggcttgccggcgctgcc
gtgtcgatcctgcccgggccggtacgtggcgccaatgaccagcgatgggcggacgcgacg
ttgacccgtttcctcgggattggggtgcgcaccgtattgagccagggttcctaccttgcc
cgcctgcgatcggtcgatacggccggcgtaacgatcggagatctcagcacggcggcgcac
accaatcgttcggccacaccggtggcgagtgaagggcccgcggtccttcaaggtaccgcg
ggatcgacgggcgcgccccgtaccgccatcctttcgccgggcgcggtgctcagcaacttg
cgtgggctcaatcagcgcgtgggcaccgatgctgcgaccgacgtcggttgctcatggtta
ccgctgtaccacgacatggggctcgctttcgtgctctctgctgcgctggccggtgcgccg
ctctggttggccccgacgacggcgttcacggcgtcgccgttccgttggttgagttggctc
tcggacagtggtgccaccatgaccgcggcaccgaacttcgcctacaacctcatcggcaaa
tacgccaggcgggtatccgaggtcgacctgggtgccctgcgagtgacgctcaacggtgga
gagccggttgactgcgatgggctgacgcggttcgcggaggcgatggcaccgttcggattc
gatgccggcgccgtgttgccctcctacgggctcgccgagtcgacgtgcgcggtgaccgtg
ccggtccccggaattgggttgcttgccgaccgtgtcatcgacggcagcggtgcgcataag
cacgcggtcctgggtaaccccatccccggtatggaggtacggatctcgtgcggtgatcag
gcggcaggcaatgcgagccgtgaaattggcgaaatcgagattcgcggtgcgtcgatgatg
gcgggttacctgggtcagcagccgatcgaccctgacgattggtttgccaccggcgacctc
ggctatcttggcgctggcggcctggtggtgtgtggtcgcgcgaaggaagtcatctccatc
gcgggacgcaacatctttccgacggaggtcgagctggtggcagcgcaagttcgcggagtg
cgcgaaggcgccgtggtcgccttgggcaccggtgatcgctcgacccgccccggtctggtg
gtcgcggccgagttccgcggcccagacgaggcgaacgcccgcgccgaactgatccaacgc
gttgcgtccgagtgcggtatcgtcccgtccgacgtcgtcttcgtgtcgcctggatcactg
ccccggacgtcgtctggaaaactgcgccgcttggcagtccggcgctccctggagatggcg
gactga

DBGET integrated database retrieval system