KEGG   Mycobacterium tuberculosis H37Rv: Rv1521Help
Entry
Rv1521            CDS       T00015                                 

Gene name
fadD25
Definition
(RefSeq) fatty-acid--CoA ligase FadD25
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
1712302..1714053
Genome map
AA seq 583 aa AA seqDB search
MSVVESSLPGVLRERASFQPNDKALTFIDYERSWDGVEETLTWSQLYRRTLNLAAQLREH
GSTGDRALILAPQSLDYVVSFIASLQAGIVAVPLSIPQGGAHDERTVSVFADTAPAIVLT
ASSVVDNVVEYVQPQPGQNAPAVIEVDRLDLDARPSSGSRSAAHGHPDILYLQYTSGSTR
TPAGVMVSNKNLFANFEQIMTSYYGVYGKVAPPGSTVVSWLPFYHDMGFVLGLILPILAG
IPAVLTSPIGFLQRPARWIQMLASNTLAFTAAPNFAFDLASRKTKDEDMEGLDLGGVHGI
LNGSERVQPVTLKRFIDRFAPFNLDPKAIRPSYGMAEATVYVATRKAGQPPKIVQFDPQK
LPDGQAERTESDGGTPLVSYGIVDTQLVRIVDPDTGIERPAGTIGEIWVHGDNVAIGYWQ
KPEATERTFSATIVNPSEGTPAGPWLRTGDSGFLSEGELFIMGRIKDLLIVYGRNHSPDD
IEATIQTISPGRCAAIAVSEHGAEKLVAIIELKKKDESDDEAAERLGFVKREVTSAISKS
HGLSVADLVLVSPGSIPITTSGKIRRAQCVELYRQDEFTRLDA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtggtcgaatcctctcttcctggtgtgctgcgtgaacgcgccagttttcagccc
aacgacaaagcgctcacctttatcgattacgagcggtcctgggatggtgttgaagaaact
ctgacgtggtcgcagttatatcggcgaacgcttaacctcgccgcacagctaagagaacat
gggtcgaccggcgatcgggcattaattctggcgccacaaagcctcgactatgtcgttagc
tttattgcctcgctgcaggccggaattgtcgcggttccgctttcgattccccagggtggt
gcccacgacgagcgcaccgtttccgtgttcgccgataccgcaccggcgatcgttctcacg
gcgtcctcggtcgtcgacaatgtcgtcgaatacgtccagccgcagcccggccaaaacgca
ccggcggtgatcgaagtcgatcggctggatcttgatgctcggccgagctccggttctcgt
tctgccgctcacggccatccggatatcttgtacttgcagtacacctcgggttccacgcgc
acgccggccggtgtcatggtctcgaataagaatcttttcgccaatttcgaacaaattatg
accagttactacggcgtctatggcaaggtcgccccgccaggctccaccgtggtgtcgtgg
ttgccgttctatcacgacatgggtttcgtcttgggactgatattgccgattctggctggc
atccccgccgtgctgaccagcccgatcggtttcctgcagcgcccggctcgctggatacag
atgttggcaagcaacactcttgcgtttaccgccgcgccgaacttcgcattcgatctggcg
tctcgtaagaccaaagacgaggacatggagggcctcgatctcggtggcgtacacggcatc
ctcaacggcagcgaacgggtgcagccggtgacgctgaagcgcttcatcgaccggttcgcc
ccgttcaatcttgaccccaaggcgatacgtccgtcgtacggaatggcagaggccacggta
tatgtggccacccgcaaggcgggtcaaccgccaaagatagtgcaattcgatccccagaag
ctgccggacggccaagctgagcggaccgaaagcgacggcggcacaccgctggtcagctac
ggcatcgtcgacacccagctggtgcgcatcgtcgacccggacaccggcatcgagcgcccc
gcgggaacgatcggtgagatttgggtgcacggcgacaacgtcgccatcggctattggcag
aaacccgaggcgaccgaacgcacctttagcgcaacgatcgtcaatccctccgaaggcaca
cccgcaggaccatggctgcggacgggagattcgggtttcctctccgagggtgagctgttc
atcatggggcgcatcaaggacctcttgatcgtgtacgggcgcaaccactctcccgacgat
atcgaggcgacgattcagacgatcagtccgggccgctgtgcggcgatcgctgtttccgag
catggtgctgagaagctggttgccattattgaactcaagaagaaggacgagtccgacgac
gaggcggcggaacgactgggtttcgtgaaacgcgaagtgacctcggcaatctcgaagtcg
cacgggttgagcgtggcggatcttgtgctcgtctccccgggctcaatcccaatcaccacc
agcggcaagatccggcgagcacagtgtgtggagctgtaccgtcaggacgagttcactcgc
ctggacgcatag

DBGET integrated database retrieval system