KEGG   Mycobacterium tuberculosis H37Rv: Rv1529Help
Entry
Rv1529            CDS       T00015                                 

Gene name
fadD24
Definition
(RefSeq) fatty-acid--CoA ligase FadD24
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
1729502..1731256
Genome map
AA seq 584 aa AA seqDB search
MVASSIPTALRERASVHPNGAAITYIDYEQDWAGVAETLTWSQLYRRMLNVAEPLRHVGA
TGDRAVILAPQGIEYVVGFLGALQAGRIAVPLPVPHAGAHDERTISVLSDTSPAVILTTS
GAVDDVRECAQPQPGQSAPSIVELDLLDLDSRQRSRSPGARPTGRDTPETAYLQYTSGST
RTPAGVMVSNKNVFANFEQIVADFFAPEGGVVPPDLTVVSWLPLYHDMGLLLGAIMPILA
GVPTVLTSPVGFLQRPARWIQLLARNGRTISAGPNFAFELAVRKTSDDDMDGLDLAGVHT
ILNGSERVHPATLKRFAERFGRFNFAAAALRPAYGMAEATVYIATRNVNEPPEIVDFESE
KLPAGQAIRCPSGSGTPLVSYGVPRSQLVRIVDPDTCIECPQGSVGEIWVQGGNVASGYW
HKPEESKRTFGARIVTPSAGTPEAPWLRTGDSGFVSGGELFIIGRIKDLLIVYGRNHAPD
DIEATIQEITSGRCAAIAVPDHGTEKLVAIIELKKRGDSDEDVADRLRIVKRDVAAAIFD
SHGLSVADLVLVSPGSIPITTSGKIRRAQCVQLYRRREFTRLDA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcgtcttcgattcccaccgcgctgcgcgagcgcgccagtgtgcaccccaatggt
gcggccatcacctacatcgattacgagcaggactgggccggtgttgccgaaaccctgacc
tggtctcagttgtatcggcgaatgctcaatgtcgccgagccgctccggcatgtgggggcg
accggtgatcgggcagtgatactggcaccgcagggaatcgaatacgtcgttggatttctc
ggcgcgttgcaggccggacgtatcgcggttccgctgccggttccacatgccggcgcccac
gatgagcgtacgatttcggtgctaagcgacacttcgcccgctgtcattctgacgacgtcg
ggggccgttgacgatgtcagagaatgcgctcagccacagccaggccagtccgcaccatca
atcgttgagcttgatttgctggacttagattctcggcagcgctcccgcagccctggcgcg
cgcccaaccggcagggatacgccggaaaccgcgtatttgcaatatacttcgggatccacc
cgtacgccggccggtgtcatggtctcgaacaaaaatgtcttcgccaatttcgagcagatc
gtggccgacttctttgcgcccgaggggggcgtcgtcccgccggacctcactgtggtgtct
tggctgccgctgtaccacgacatgggtcttctattaggcgcgatcatgccgatcctggcg
ggtgtacccaccgtgttgacgagtccggtggggttccttcagcggccggctcgatggata
caactgctggcacgtaacggtcgcacgatttcggcaggaccgaatttcgctttcgaattg
gcggtgcgtaagacgtcagacgacgacatggacggacttgacctcgccggcgtgcacacc
atcctcaacggcagcgagcgagtacacccggcgaccctcaaacgatttgctgaacggttc
ggccgctttaattttgccgccgcggcgctgcggcccgcgtatggcatggcggaagcaacg
gtgtacatagcgacccgtaatgtgaacgaaccaccagaaatcgtcgacttcgaatccgag
aaactgcctgcgggccaagcgatccggtgcccgagcggaagcggcacaccgctggtcagc
tacggcgtcccacggtcacagctagtgcgcatcgttgatccagacacgtgtatcgagtgt
ccgcagggatcggtcggtgagatctgggtgcaaggtggcaacgttgcgtccggctattgg
cacaaacccgaggagagcaagcgcacgtttggcgccaggattgtcaccccttcggcgggc
acacccgaagcgccttggctgcgaaccggggattcgggtttcgtctccggcggcgagctg
ttcatcatcggccgcatcaaggacctcttgattgtgtatgggcgcaaccacgctcccgac
gacatcgaggcgaccatccaggagataacctccggccgctgtgcggcgatcgcggtcccc
gaccacggcaccgaaaagctggtcgcgattatcgaactcaagaaacggggagactccgac
gaggatgtggcggaccggctgcgcatcgtcaagcgtgacgtcgccgcggcgatatttgat
tcgcacggtctgagcgtggccgatctcgttctggtgtcgcccgggtcgattcccatcacc
accagcggcaagatcaggcgggcacagtgcgtccagctttaccgacggcgtgagttcacc
cggttagacgcttga

DBGET integrated database retrieval system