KEGG   Mycobacterium tuberculosis H37Rv: Rv1550Help
Entry
Rv1550            CDS       T00015                                 

Gene name
fadD11
Definition
(RefSeq) fatty-acid--CoA ligase FadD11
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
1753716..1755431
Genome map
AA seq 571 aa AA seqDB search
MARLRGAGAAGRCRPGRFGSSARRHGLADDGEPDRVLPARRRCSARRRHLVFGVQHPARR
AADLRVRQRGDQGGHLRATVRRSRSRQRCAHRTHRLRRWRAPGTLSLTDLYAAASGDFFD
FESTWRAVQPEDIVTLIYTSGTTGNPKGVEMTHANLLFEGYAIDEVLGIRFGDRVTSFLP
SAHIADRMTGLYLQEMFGTQVTAVADARTIAAALPDVRPTVWGAVPRVWEKLKAGIEFTV
ARETDEMKRQALAWAMSVAGKRANALLAGESMSDQLVAEWAKADELVLSKLRERLGFGEL
RWALSGAAPIPKETLAFFAGIGIPIAEIWGMSELSCVATASHPRDGRLGTVGKLLPGLQG
KIAEDGEYLVRGPLVMKGYRKEPAKTAEAIDSDGWLHTGDVFDIDSDGYLRVVDRKKELI
INAAGKNMSPANIENTILAACPMVGVMMAIGDGRTYNTALLVFDADSLGPYAAQRGLDAS
PAALAADPEVIARIAAGVAEGNAKLSRVEQIKRFRILPTLWEPGGDEITLTMKLKRRRIA
AKYSAEIEELYASELRPQVYEPAAVPSTQPA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcgagactacgcggcgcaggtgcggcgggtcgctgccggcctggcaggtttgggagt
tcggcgcggcgacacggtctcgctgatgatggcgaaccggatcgagttctacccgctcga
cgtcggtgctcagcacgtcggcgccacctcgttttcggtgtacaacaccctgcccgccga
gcagctgacctacgtgttcgacaacgcggggaccaaggtggtcatctgcgagcaacagta
cgtcgatcgcgttcgcgccagcggtgtgcccatcgaacacatcgtctgcgtcgatggcgc
gcccccggcacgctctcgctgacggatttgtacgcggccgcctccggcgacttcttcgac
ttcgagtcgacgtggcgtgccgtacaacccgaggacattgtcaccctcatctacacgtcc
ggcacaacgggaaaccccaagggtgtggagatgacccacgccaacctgctgttcgagggg
tatgccatcgacgaggtgctcggaatccggtttggcgatcgggtgacgtccttcctgcca
tcggcgcacatcgccgatcggatgaccgggctgtacctgcaggagatgttcggcacccag
gtcaccgcggtggccgacgcgcgcacgatcgcagccgcgctccccgacgtgcggccaacc
gtgtggggggccgttccccgggtttgggaaaagcttaaggccggaatcgaattcaccgtc
gctcgtgagaccgacgagatgaagcggcaggcgttggcgtgggcgatgtcggtggctggc
aaacgcgccaacgccctgctcgcaggtgaatctatgtcggatcagctggtcgccgaatgg
gccaaagccgacgagttggtgttgtccaagttgcgcgagcggctgggcttcggcgagctg
cggtgggccctgtccggagcggcgccgatccccaaggagacgctcgcgttcttcgcaggt
atcggcatcccaatcgccgagatttggggaatgtcggagctgagctgcgttgccaccgcc
agccatccccgcgacgggcggctgggcaccgtcggaaaactacttcccgggctgcagggc
aagatcgccgaagacggtgagtacctggtccgcggtccgctggtgatgaagggttatcgc
aaagaaccggccaagaccgcggaggcgatcgactccgacggctggctacacaccggagat
gtcttcgatatcgactccgacggctatctgcgggtggtggaccgcaagaaggagctgatc
atcaatgcggccggaaaaaacatgtcgccggccaacatcgagaacaccatcctggccgcg
tgccccatggtcggggtgatgatggcaatcggtgacgggcgaacgtataacaccgcgctg
ttggtcttcgacgccgactctctcggtccgtatgcggcccagcgtggcctcgatgcctcg
cccgcggctctggcggctgacccggaggtgatcgcgcgcatcgccgccggcgtggccgag
ggcaacgccaaattatcgcgggtcgaacagatcaagcggttccgcatattgcccaccctg
tgggagcccggcggggacgagataaccctgacgatgaaactcaagcgccgtcgaatcgcc
gcgaaatattccgcggagatcgaggagctctacgccagcgagctgagaccgcaggtttac
gagcccgctgccgtgccatcgacacaaccggcatga

DBGET integrated database retrieval system