KEGG   Mycobacterium tuberculosis H37Rv: Rv2194Help
Entry
Rv2194            CDS       T00015                                 

Gene name
qcrC
Definition
(RefSeq) ubiquinol-cytochrome C reductase cytochrome subunit C
  KO
K03889  
ubiquinol-cytochrome c reductase cytochrome c subunit
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv2194 (qcrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
2457553..2458395
Genome map
AA seq 280 aa AA seqDB search
MTKLGFTRSGGSKSGRTRRRLRRRLSGGVLLLIALTIAGGLAAVLTPTPQVAVADESSSA
LLRTGKQLFDTSCVSCHGANLQGVPDHGPSLIGVGEAAVYFQVSTGRMPAMRGEAQAPRK
DPIFDEAQIDAIGAYVQANGGGPTVVRNPDGSIATQSLRGNDLGRGGDLFRLNCASCHNF
TGKGGALSSGKYAPDLAPANEQQILTAMLTGPQNMPKFSNRQLSFEAKKDIIAYVKVATE
ARQPGGYLLGGFGPAPEGMAMWIIGMVAAIGLALWIGARS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaactggggttcacccgatccggtggcagtaagagtggtcgcacgcgacggcgc
ctgcgccgccgattgtccggcggagtgttgctgctgatagcgctgaccatcgccggtgga
ttggcagctgtgctgacccctaccccacaggtggccgtcgccgacgaatcctcctcggcg
ttgctgcgcaccggcaaacaacttttcgacacctcgtgtgtgtcctgccatggcgccaac
ctgcagggcgtgcccgaccacgggccgagtctgatcggggtcggcgaggccgccgtctac
ttccaggtgtcgaccggccggatgccggccatgcgcggcgaggcacaggcgccgcgcaaa
gatccgatcttcgacgaagcacagatcgacgcgatcggcgcctacgtgcaagccaatggc
ggtgggccgacggtggtacgtaaccccgatggcagcattgcaacgcagtcgctacgtggc
aacgacctgggccgcggcggcgacttgttccggctcaactgcgcctcgtgtcacaacttc
accggcaagggcggagcattgtcgtccggcaaatacgcacccgaccttgcgcccgccaat
gaacagcaaatcctcaccgcgatgctgacgggtccacagaacatgccgaagttctccaac
cgccagctctccttcgaagcgaaaaaggacatcattgcctacgtgaaggtcgccaccgag
gcgcggcagcccggtggttacctactcggcggattcggacccgcacccgaaggcatggcc
atgtggatcatcggaatggtcgccgcgatcgggctggcactgtggattggggcgcgatca
tga

DBGET integrated database retrieval system